KEGG   Amycolatopsis mediterranei S699: AMES_7372Help
Entry
AMES_7372         CDS       T02190                                 

Gene name
lacZ
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:amm00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8278403..8280157)
Genome map
AA seq 584 aa AA seqDB search
MPEFAIGEHDFLLDGRPFRILSGALHYFRVHPDLWADRIDKARRMGLNTIETYVAWNAHA
PEPGTFDLSGGLDLDRFLRLVADAGMYAIVRPGPYICAEWDNGGLPAWLFRDPSVGVRRY
EPKYLDAVREYLTKVYEVVVPHQIDRGGPVLLVQVENEYGAFGDDKRYLKALAEHTREAG
VTVPLTTVDQPTPEMLEAGSLDGLHRTASFGSGAEARLAILRAHQPTGPLMCSEFWNGWF
DHWGAHHHTTSAADSAAELDALLAAGASVNLYMFHGGTNFGLTNGANDKGVYQPLITSYD
YDAPLDEAGDPTPKYHAFRDVIARYHKVPDTVPPPARPAPTPSGVLGDPVRLLDAPERWG
TWEFHEELPAFDDLTPMPQLALLRCAVEGDRSGVLTFGEVRDRATVFFDGDLVGTLSRDH
HERAIPLPRGRGELLVLVEDQGRVDYGPRIGEAKGIIGGASLQGEPLAGWDVLPLDLAAL
PALRPPAPESVTGAVAGPVVLRTEIDLDEPADLFLDTGEWGKGVAWLNGFALGRYWRRGP
QRTLYVPRPVVRAGANELVVLELGTMLDPAARFVPRPLLGHTEA
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttcgccatcggggagcacgacttcctgctcgacgggcgcccgttccgcatc
ctgtccggcgccctgcactacttccgggtgcacccggacctgtgggccgaccggatcgac
aaggcccggcggatggggctcaacaccatcgagacgtacgtggcgtggaacgcgcacgcc
cccgaacccggcacgttcgacctgtcgggcggcctcgacctcgaccgcttcctgcggctc
gtggccgatgccgggatgtacgcgatcgtgcggcccggcccgtacatctgcgccgagtgg
gacaacggcgggctgcccgcgtggctgttccgcgacccgtcggtcggggtgcgccggtac
gagccgaagtacctggacgccgtccgcgagtacctcacgaaggtgtacgaggtcgtcgtc
ccgcaccagatcgaccgcggcgggccggtgctgctggtccaggtggaaaacgaatatggg
gcgttcggcgacgacaagcgctacctgaaagcgcttgccgagcacacgcgcgaagccggc
gtcaccgtgccactgaccacagtggaccagccgacgccggagatgctggaagcgggcagc
ctcgacgggctgcaccgcaccgcgtcgttcgggtccggcgccgaggcgcggctggcgatc
ctgcgcgcgcaccagccgaccgggccgctgatgtgcagcgagttctggaacggctggttc
gaccactggggcgcgcaccaccacacgacctcggccgcggactcggcggcggagctcgac
gcgctgctcgccgcgggcgcgtcggtcaacctctacatgttccacggcggcaccaacttc
ggcctcaccaacggcgccaacgacaagggcgtctaccagccgctgatcacctcctacgac
tacgacgcgccgctggacgaagccggcgacccgacgccgaagtaccacgccttccgggac
gtgatcgcccgctaccacaaggtgcccgacacggtcccgccgccggcgcggcccgcgccg
acgccgtccggggtgctcggcgacccggtccggctgctcgacgcgccggaacgctggggc
acctgggagttccacgaggaactgcccgcgttcgacgacctgacgccgatgccgcagctc
gcgctgctgcgctgtgccgtcgagggggaccggtccggggtgctgaccttcggcgaggtc
cgcgaccgcgccacggtgttcttcgacggcgacctggtgggcacgctcagccgggaccac
cacgagcgcgcgatcccgctgccgcgtggccgcggcgagctgctggtgctggtcgaggac
cagggccgcgtcgactacggcccgcgcatcggcgaggcgaagggcatcatcggcggggcg
tcgctgcagggcgagccgctggccggctgggacgtgctgccgctcgacctggccgcgctg
cccgcgctgcggccgcccgcgccggagtccgtgacgggtgcggtggccgggccggtggtg
ctgcgcaccgagatcgacctcgacgagcctgccgacctcttcctcgacaccggggagtgg
ggcaagggcgttgcgtggctcaacggcttcgcgctcggccggtactggcggcgggggccg
caacggacgttgtacgtgccgcgcccggtggtccgggccggtgccaacgaactcgtcgtg
ctcgaactcggcacgatgctcgaccccgcggcccggttcgtgccgcggccgctgctcggc
cacaccgaggcctga

DBGET integrated database retrieval system