KEGG   Amycolatopsis mediterranei S699: AMES_8105Help
Entry
AMES_8105         CDS       T02190                                 

Gene name
desC
Definition
stearoyl-CoA desaturase (delta-9 desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AMES_8105 (desC)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AMES_8105 (desC)
Enzymes [BR:amm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     AMES_8105 (desC)
Lipid biosynthesis proteins [BR:amm01004]
 Desaturase
  First
   AMES_8105 (desC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9065376..9066341)
Genome map
AA seq 321 aa AA seqDB search
MTATLDRSQPAGEPSAPKGPKPVTEGTRGMGVQLSVYFGVIAPLVALLVAVPFAWGWGLS
WVDVGIFVVFYAISGLGITVSYHRYFTHGSFKAKQWLRVFMAIAGSIALQGPVITWVADH
RRHHAFSDRDGDPHSPWAFGTSPWAIAKGFWHAHMGWLFERDQTNAERFAPDLVKDPAIK
KVDDLFWLWALVSLLLPAILGGLISWSFWGAVTAFFWAGLVRICVLHHVTWSINSICHMI
GDRPFNARDNSANFWPLAIFSFGESWHNLHHADPTSARHGVKRGQIDISARLIWIFEKFG
WVHDVRWPTPQRLARITTEKA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacggccacgctcgaccgttctcagcccgccggagaaccttcggccccgaagggcccc
aaaccagtcaccgagggcacgcgcggcatgggcgtgcagctgtcggtctacttcggcgtg
atcgcgccgctggtggccctcctggtcgccgtgccgttcgcgtggggctggggactgagc
tgggtcgacgtcggcatcttcgtggtgttctacgcgatcagcgggctcggcatcacggtg
tcctaccaccgctacttcacgcacggttcgttcaaggccaagcagtggctgcgcgtgttc
atggccatcgcgggcagcatcgccctgcagggcccggtgatcacctgggtcgccgaccac
cgccgccaccacgcgttctccgaccgcgacggcgacccgcactcgccgtgggcgttcggc
acctcgccgtgggccatcgccaagggcttctggcacgcgcacatgggctggctgttcgag
cgcgaccagaccaacgccgagcgcttcgcgccggacctggtgaaggacccggcgatcaag
aaggtcgacgacctgttctggctgtgggcgctggtcagcctgctgctgccggccatcctc
ggcgggctcatctcctggtcgttctggggcgccgtgacggcgttcttctgggccggcctg
gtccgcatctgcgtgctgcaccacgtgacgtggtcgatcaactcgatctgccacatgatc
ggcgaccgcccgttcaacgcccgggacaactcggccaacttctggccgctggcgatcttc
tcgttcggcgagtcctggcacaacctgcaccacgccgacccgacgtccgcccgccacggt
gtgaagcgcggccagatcgacatctccgcgcggctgatctggatcttcgaaaagttcggc
tgggtgcacgacgtccgctggccgacgccgcagcgcttggcccgtatcaccaccgaaaaa
gcctag

DBGET integrated database retrieval system