KEGG   Amycolatopsis mediterranei S699: AMES_8119Help
Entry
AMES_8119         CDS       T02190                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:amm00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9080239..9081201)
Genome map
AA seq 320 aa AA seqDB search
MLAVVPPPVTVRVPAKVNLHLAVDDLREDGYHELVTVFQALSLTDEVTVAVTEEPGIEVY
GEGEGSVPTGPKNLAWRAVEALAGHVGRAGEPKVRVVLRKGIPVAGGMAGGSADAAATLV
GLASLWNLDVTRDELAEIAAGLGSDVPFALYGGTALGTGRGEQLVPVLSRHTFHWVLAFA
AEGLSTPKVFGELDRLRAAGNPPRIGSHTPVVEALASGDPRQLALLLGNDLQAAAVSLRP
DLRRTLRAGVNAGALAGTVSGSGPTCAFLCEDAQSAVEVAAELSGAGVCRTVRVAHGPVP
GARVVGGDDANRPTPPRVHA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgccgtagttccgcccccagtcaccgtccgggtcccggccaaggtgaacctgcac
cttgcggtcgacgacctgcgcgaagacggttaccacgagctggtgaccgtcttccaggcg
ctgtcgctgaccgacgaagtgaccgtcgcggtcaccgaagagcccggcatcgaggtctac
ggcgagggggagggctcggtcccgaccggcccgaagaacctggcctggcgggcggtcgaa
gcgctggccgggcacgtcggccgcgccggggagccgaaggtccgggtggtgctgcgcaag
ggcatcccggtggccggcggcatggcgggcggcagtgccgacgccgcggcgacgctcgtc
gggctggcgagcctgtggaacctcgacgtcacccgggacgagctggccgaaatcgccgcc
ggcctgggcagcgacgtcccgttcgcgctctacggcggcaccgcgctgggtaccggccgc
ggtgagcagctggtcccggtgctgtcgcggcacacgttccactgggtgctggccttcgcc
gccgaagggctgtccacgccgaaggtgttcggcgaactggaccgcctgcgcgcggcgggc
aacccgccccggatcggctcgcacacgccggtcgtcgaggcgctggcctccggcgacccg
cgccagctggccctgctgctgggcaacgacctgcaggcggcggcggtctcgctgcggccc
gacctgcgccgcacgctccgggcgggggtcaacgcgggcgcgctcgcgggcacggtgtcc
ggctccggcccgacgtgcgcgttcctctgcgaagacgcgcagtcggcggtggaggtcgcg
gccgagctgtcgggtgccggcgtgtgccggacggtccgcgtggcccacggcccggtcccc
ggcgcccgcgtggtcggcggcgacgacgcgaaccggccgacgccgccgcgggtgcacgcg
tga

DBGET integrated database retrieval system