KEGG   Amycolatopsis mediterranei S699: AMES_8183Help
Entry
AMES_8183         CDS       T02190                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00040  Pentose and glucuronate interconversions
amm00052  Galactose metabolism
amm00500  Starch and sucrose metabolism
amm00520  Amino sugar and nucleotide sugar metabolism
amm01100  Metabolic pathways
amm01130  Biosynthesis of antibiotics
Module
amm_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AMES_8183 (galU)
   00052 Galactose metabolism
    AMES_8183 (galU)
   00500 Starch and sucrose metabolism
    AMES_8183 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    AMES_8183 (galU)
Enzymes [BR:amm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AMES_8183 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75
Motif
Other DBs
NCBI-ProteinID: AFO81716
UniProt: G0FZ37
Position
complement(9161558..9162463)
Genome map
AA seq 301 aa AA seqDB search
MTGAATTQTFRTAIVPAAGLGTRFLPATKAVPKELLPVVDTPGIELVAAEAAAAGAERLV
IVTSPGKDAVVRYFEKQPELERNLEAKGKTELLAKVRRGTDLLAVETAIQEQALGLGHAV
AQAEPNLRPDDEAVAVLLPDDLVLPTGVLERMGAVRAQYGGSVLCAFDIPKAEISPYGVF
DVTDTDDEDVKQVHGMVEKPKPEDAPSTYAAAGRYLLDRAIFDALKRITPGSGGELQLTD
AVALLISEGHPVHVVVHRGGRHDLGNPGGFLRAAVDFALETPEYGPSLRAWLTERIGTER
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgccgcaaccacccagacgttcagaaccgccatcgtgcctgccgccggcctg
gggacacggttcctcccggcgacgaaggccgtgcccaaggagctcctgccggtggtggac
accccgggcatcgagctggtcgcggccgaggccgccgccgccggcgcggaacgcctggtc
atcgtgacctcgccgggcaaggacgccgttgtccggtacttcgaaaagcagcccgagctc
gagcggaacctcgaggccaagggcaagaccgaactgctcgccaaggtgcgccggggcacc
gatctcctcgccgtcgaaaccgccatccaggaacaggccctcggcctgggccacgccgtc
gcgcaggccgagccgaacctgcgcccggacgacgaggccgtcgccgtgctgctcccggac
gacctcgtgctgcccaccggcgtgctcgagcggatgggcgcggtccgcgcccagtacggc
ggcagcgtgctctgcgcgttcgacatcccgaaggccgagatctcgccgtacggcgtcttc
gacgtcaccgacaccgacgacgaagacgtcaagcaggtgcacgggatggtcgagaagccg
aagccggaggacgcgccgtcgacctacgccgcggccgggcggtacctgctcgaccgggcg
atcttcgacgcgctcaagcggatcaccccgggcagcggcggcgagctgcagctgaccgac
gcggtcgcgctgctgatcagcgagggacacccggtgcacgtcgtcgtccaccgcggcgga
cgccacgacctggggaatccgggtggtttcctgcgcgccgcggtcgatttcgcgcttgaa
acgcccgagtacggtccatctttacgggcgtggctgacggaacggatcgggacagagcgc
ccatga

DBGET integrated database retrieval system