KEGG   Amycolatopsis mediterranei S699: AMES_8183Help
Entry
AMES_8183         CDS       T02190                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AMES_8183 (galU)
   00052 Galactose metabolism
    AMES_8183 (galU)
   00500 Starch and sucrose metabolism
    AMES_8183 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    AMES_8183 (galU)
Enzymes [BR:amm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AMES_8183 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9161558..9162463)
Genome map
AA seq 301 aa AA seqDB search
MTGAATTQTFRTAIVPAAGLGTRFLPATKAVPKELLPVVDTPGIELVAAEAAAAGAERLV
IVTSPGKDAVVRYFEKQPELERNLEAKGKTELLAKVRRGTDLLAVETAIQEQALGLGHAV
AQAEPNLRPDDEAVAVLLPDDLVLPTGVLERMGAVRAQYGGSVLCAFDIPKAEISPYGVF
DVTDTDDEDVKQVHGMVEKPKPEDAPSTYAAAGRYLLDRAIFDALKRITPGSGGELQLTD
AVALLISEGHPVHVVVHRGGRHDLGNPGGFLRAAVDFALETPEYGPSLRAWLTERIGTER
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgccgcaaccacccagacgttcagaaccgccatcgtgcctgccgccggcctg
gggacacggttcctcccggcgacgaaggccgtgcccaaggagctcctgccggtggtggac
accccgggcatcgagctggtcgcggccgaggccgccgccgccggcgcggaacgcctggtc
atcgtgacctcgccgggcaaggacgccgttgtccggtacttcgaaaagcagcccgagctc
gagcggaacctcgaggccaagggcaagaccgaactgctcgccaaggtgcgccggggcacc
gatctcctcgccgtcgaaaccgccatccaggaacaggccctcggcctgggccacgccgtc
gcgcaggccgagccgaacctgcgcccggacgacgaggccgtcgccgtgctgctcccggac
gacctcgtgctgcccaccggcgtgctcgagcggatgggcgcggtccgcgcccagtacggc
ggcagcgtgctctgcgcgttcgacatcccgaaggccgagatctcgccgtacggcgtcttc
gacgtcaccgacaccgacgacgaagacgtcaagcaggtgcacgggatggtcgagaagccg
aagccggaggacgcgccgtcgacctacgccgcggccgggcggtacctgctcgaccgggcg
atcttcgacgcgctcaagcggatcaccccgggcagcggcggcgagctgcagctgaccgac
gcggtcgcgctgctgatcagcgagggacacccggtgcacgtcgtcgtccaccgcggcgga
cgccacgacctggggaatccgggtggtttcctgcgcgccgcggtcgatttcgcgcttgaa
acgcccgagtacggtccatctttacgggcgtggctgacggaacggatcgggacagagcgc
ccatga

DBGET integrated database retrieval system