KEGG   Amycolatopsis mediterranei S699: AMES_8250Help
Entry
AMES_8250         CDS       T02190                                 

Gene name
srfJ
Definition
glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AMES_8250 (srfJ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AMES_8250 (srfJ)
Enzymes [BR:amm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     AMES_8250 (srfJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9229377..9231212
Genome map
AA seq 611 aa AA seqDB search
MIGVSAVAAATFAGPARAAGETVNVWLTTTSDAGGRTVTRGLQQQAPITFAAGTGSGGVT
INVNENTTYQQFEGGGASFTDTAAWLMNSSGALSQATRDDTMRKLFDPNTGIGLSFIRNP
LGASDLARYSYTFDDVPAGQTDPNLTHFSIAHDQADVLPLTKQAKQLNPQAKIMASPWSA
PPWMKDNDSYLLGWVESQYYPAYAQYFVKYLQAYRDAGVPIDYVSMQNEPTCCASYPSTN
WNGAGLAYFAKNNLLPALQGAGLSTKVLALDWNWDTYASYGAPTLDDSAIRNHPNFGGVA
WHGYGGDIAQQTTTHNQYPTVNAYSTEHSGGTWISNQQAEDMNNIVDYTRNWSKSVTKWS
LAVDQNMGPHNGGCGTCTGLITVHNGDSRSGQVDYTVEYYTMGHLTKFVKPGAYRIDSND
SSAVRNVAWKNPDGSKALIAYNSGTGNQSVRVNWGNSSFTYTLPGRTSATFTWSGTQGTG
GGTGKTGPITGLGGKCVDVAGANSANGTAVQLYDCNGSGAQQWTVGTDGTLKALGKCLDV
TGQSTTDGAQLQLWDCGGTANQRWAATAAKDLVGAGSDKCVDATGNSSANGTRLQIWTCT
GAANQKWNVPA
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
ttgatcggggtgtccgcggtcgccgcggccaccttcgccgggcccgcgcgggccgcgggc
gagacggtcaacgtctggctcaccacgaccagcgacgccggcggccggacggtcacccgc
gggctccagcagcaggcaccgatcacgttcgccgcgggcaccggcagcggcggcgtgacc
atcaacgtcaacgaaaacaccacctaccagcagttcgaaggcggcggagcgtcctttacg
gacaccgcggcctggctgatgaactccagcggggcgctgtcccaggccacccgcgacgac
accatgcgcaagctgttcgacccgaacaccggcatcggcctgagcttcatccgcaacccg
ctgggcgcgtccgacctggcccgctacagctacaccttcgacgacgtgccggccggccag
accgacccgaacctgacgcacttctccatcgcccacgaccaggccgacgtgctgccgctg
accaagcaggccaagcagctcaacccgcaggccaagatcatggcgtcgccgtggagcgcg
ccgccgtggatgaaggacaacgacagctacctgctcggctgggtcgaatcgcagtactac
ccggcctacgcgcagtacttcgtcaagtacctccaggcctaccgggacgcgggcgtgccg
atcgactacgtctcgatgcagaacgagccgacgtgctgcgcgagctacccgtcgaccaac
tggaacggcgcgggcctggcgtacttcgcgaagaacaacctacttcccgcactgcagggt
gccggtctgtccaccaaggtcctcgcactcgactggaactgggacacctacgcgtcctac
ggcgcgccgaccctggacgactcggcgatccggaaccacccgaacttcgggggtgtggcg
tggcacggctacggcggtgacatcgcccagcagacgaccacgcacaaccagtacccgact
gtcaacgcctactccaccgagcactccggcggcacctggatctcgaaccagcaggccgaa
gacatgaacaacatcgtggactacacccggaactggtcgaagagcgtgaccaagtggagc
ctcgccgtcgaccagaacatgggcccgcacaacggcggctgcggtacctgcaccgggctg
atcaccgtccacaacggagactcgcgcagcgggcaggtcgactacaccgtcgagtactac
acgatgggccacctgacgaagttcgtgaagccgggcgcgtaccggatcgactcgaacgac
agctcggccgtccggaacgtcgcctggaagaacccggacggctcgaaggcgctgatcgcg
tacaactccggcacgggcaaccagagcgtgcgggtgaactggggcaactcgtcgttcacc
tacaccctgcccggccgcacgtcggcgacgttcacctggagcggcacccagggcaccggc
ggcggcaccggcaagaccggcccgatcaccggcctcggcggcaagtgcgtcgacgtcgcc
ggcgcgaacagcgccaacggcaccgccgtccagctctacgactgcaacggctccggcgcc
cagcagtggacggtcggcaccgacggaaccctgaaggcgctcggcaagtgcctcgacgtc
accgggcagtccacaacggacggtgcccagctgcagctctgggactgcggcggcacggcc
aaccaaaggtgggccgcaaccgcggccaaggacctcgtcggcgccggttcggacaagtgc
gtcgacgccaccggcaactccagcgccaacggcacccggctgcagatctggacctgcacc
ggcgccgccaaccagaagtggaacgtgcccgcatga

DBGET integrated database retrieval system