KEGG   Amycolatopsis mediterranei S699: AMES_8250Help
Entry
AMES_8250         CDS       T02190                                 

Gene name
srfJ
Definition
glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:amm00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:amm00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9229377..9231212
Genome map
AA seq 611 aa AA seqDB search
MIGVSAVAAATFAGPARAAGETVNVWLTTTSDAGGRTVTRGLQQQAPITFAAGTGSGGVT
INVNENTTYQQFEGGGASFTDTAAWLMNSSGALSQATRDDTMRKLFDPNTGIGLSFIRNP
LGASDLARYSYTFDDVPAGQTDPNLTHFSIAHDQADVLPLTKQAKQLNPQAKIMASPWSA
PPWMKDNDSYLLGWVESQYYPAYAQYFVKYLQAYRDAGVPIDYVSMQNEPTCCASYPSTN
WNGAGLAYFAKNNLLPALQGAGLSTKVLALDWNWDTYASYGAPTLDDSAIRNHPNFGGVA
WHGYGGDIAQQTTTHNQYPTVNAYSTEHSGGTWISNQQAEDMNNIVDYTRNWSKSVTKWS
LAVDQNMGPHNGGCGTCTGLITVHNGDSRSGQVDYTVEYYTMGHLTKFVKPGAYRIDSND
SSAVRNVAWKNPDGSKALIAYNSGTGNQSVRVNWGNSSFTYTLPGRTSATFTWSGTQGTG
GGTGKTGPITGLGGKCVDVAGANSANGTAVQLYDCNGSGAQQWTVGTDGTLKALGKCLDV
TGQSTTDGAQLQLWDCGGTANQRWAATAAKDLVGAGSDKCVDATGNSSANGTRLQIWTCT
GAANQKWNVPA
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
ttgatcggggtgtccgcggtcgccgcggccaccttcgccgggcccgcgcgggccgcgggc
gagacggtcaacgtctggctcaccacgaccagcgacgccggcggccggacggtcacccgc
gggctccagcagcaggcaccgatcacgttcgccgcgggcaccggcagcggcggcgtgacc
atcaacgtcaacgaaaacaccacctaccagcagttcgaaggcggcggagcgtcctttacg
gacaccgcggcctggctgatgaactccagcggggcgctgtcccaggccacccgcgacgac
accatgcgcaagctgttcgacccgaacaccggcatcggcctgagcttcatccgcaacccg
ctgggcgcgtccgacctggcccgctacagctacaccttcgacgacgtgccggccggccag
accgacccgaacctgacgcacttctccatcgcccacgaccaggccgacgtgctgccgctg
accaagcaggccaagcagctcaacccgcaggccaagatcatggcgtcgccgtggagcgcg
ccgccgtggatgaaggacaacgacagctacctgctcggctgggtcgaatcgcagtactac
ccggcctacgcgcagtacttcgtcaagtacctccaggcctaccgggacgcgggcgtgccg
atcgactacgtctcgatgcagaacgagccgacgtgctgcgcgagctacccgtcgaccaac
tggaacggcgcgggcctggcgtacttcgcgaagaacaacctacttcccgcactgcagggt
gccggtctgtccaccaaggtcctcgcactcgactggaactgggacacctacgcgtcctac
ggcgcgccgaccctggacgactcggcgatccggaaccacccgaacttcgggggtgtggcg
tggcacggctacggcggtgacatcgcccagcagacgaccacgcacaaccagtacccgact
gtcaacgcctactccaccgagcactccggcggcacctggatctcgaaccagcaggccgaa
gacatgaacaacatcgtggactacacccggaactggtcgaagagcgtgaccaagtggagc
ctcgccgtcgaccagaacatgggcccgcacaacggcggctgcggtacctgcaccgggctg
atcaccgtccacaacggagactcgcgcagcgggcaggtcgactacaccgtcgagtactac
acgatgggccacctgacgaagttcgtgaagccgggcgcgtaccggatcgactcgaacgac
agctcggccgtccggaacgtcgcctggaagaacccggacggctcgaaggcgctgatcgcg
tacaactccggcacgggcaaccagagcgtgcgggtgaactggggcaactcgtcgttcacc
tacaccctgcccggccgcacgtcggcgacgttcacctggagcggcacccagggcaccggc
ggcggcaccggcaagaccggcccgatcaccggcctcggcggcaagtgcgtcgacgtcgcc
ggcgcgaacagcgccaacggcaccgccgtccagctctacgactgcaacggctccggcgcc
cagcagtggacggtcggcaccgacggaaccctgaaggcgctcggcaagtgcctcgacgtc
accgggcagtccacaacggacggtgcccagctgcagctctgggactgcggcggcacggcc
aaccaaaggtgggccgcaaccgcggccaaggacctcgtcggcgccggttcggacaagtgc
gtcgacgccaccggcaactccagcgccaacggcacccggctgcagatctggacctgcacc
ggcgccgccaaccagaagtggaacgtgcccgcatga

DBGET integrated database retrieval system