KEGG   Amycolatopsis mediterranei S699: AMES_8613Help
Entry
AMES_8613         CDS       T02190                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9598967..9599767)
Genome map
AA seq 266 aa AA seqDB search
MMGVLNVTPDSFSDGGRYLGLDQALEHAREMWARGADLIDVGGESTRPGASRVDSATELQ
RVLPVIKTLAAEGVALSVDTTRAAVAAAALEAGAHVINDVSGGLADPDMARVAAEAAVPW
VLMHWRGHSKDMQALAEYRDVVADVRAELRSRVDAALAAGVAESAIVLDPGLGFAKNAEH
DWALLRGLDSLRSLGFPVLVGASRKRFLGRLLSEKDGTPRSPDGREDATAAISALAAAAG
AWGVRVHEVGASLDAVAVAAAWRTDG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgatgggcgtgctgaacgtgacgcccgattccttttcggatggtggccgctacctcggg
ctcgaccaggcgctggagcacgcccgcgagatgtgggcgcggggcgccgacctgatcgac
gtcggcggcgagtcgacgcggccgggagcgtcccgagtggactccgccaccgaactgcag
cgcgtcctgccggtgatcaagacgctcgccgccgaaggggtcgcgctgtcggtcgacacc
acgcgggccgccgtcgccgccgcggcgctcgaagccggcgcgcacgtcatcaacgacgtc
tccggcgggctggccgatccggacatggcgcgcgtcgcggccgaggccgcggtgccgtgg
gtgctgatgcactggcgcgggcacagcaaggacatgcaggcgctcgccgaataccgggac
gtcgtggcggacgtgcgggccgaactgcggtccagagtggacgcggcgctcgcggccggt
gtggcggagagcgccatcgtgctggaccccgggctcgggttcgcgaagaacgccgagcac
gactgggcgttgctgcgcgggctggactcgttgcgctcgctcggtttcccggtgctcgtc
ggcgcttcgcgcaagaggttcctcggccgtcttctgtccgaaaaggacggcacgccgcgc
tcgccggacggccgggaggacgccaccgcggcgatttccgcgctcgccgcggccgccggt
gcgtggggcgtgcgcgtgcacgaggtcggggcttcgctggacgcggtcgcggtggccgcc
gcatggaggacggatggctga

DBGET integrated database retrieval system