KEGG   Amycolatopsis mediterranei S699: AMES_8675Help
Entry
AMES_8675         CDS       T02190                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:amm00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:amm00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9672813..9674570
Genome map
AA seq 585 aa AA seqDB search
MLAFTGVGVATAASAPRLSADAQAEAAATQALRGLTLEQKVGQLFVTWVNGKSADEVHPK
NQTDFGVDTPAQVIEKYHLGGVIYFNNDSRDNFDDPVQVAKLSNGLQQAAVRSGAHIPLQ
IAADQEGGTVTRMGAPATEFPNAMAVSAGRDTNRATQAATILGRELRAVGINQDFAPDSD
VNSNPVNPVIGVRSFSGQPGLASDFVTAEIKGFQDSGFPTKTVAATAKHFPGHGAAPTDS
HTGLPRIDSTEAQWRATDVPPFKAAIAAGVDSIMSAHIQFPSLDPSLEPATLSQPIITGR
LRNELGYRGVVITDSLEMEGVRRLHSDAEIPVLALKAGVDQLLMPVHLELAINSVIAAVK
SGDIPMRRIDQSVLRVLKLKFLRGILFSPFVDTGRVMKTVGIPSSLETAQDIADRGITAI
ANDAGLLPLKQKPATTLVTGWGVSTTATLAQKLTAHGTAATAYQTGQVPTDAQIAQAVAK
AQSADLVVVLTNNIATYPLQTNLLNALQATGKPVVAVAAQIPYDAGYPSTVRTWLATYGY
ITPTLEALAKVIVGETKPIGKLPVDIPAGADMQTVKYPFGHGLTW
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgccttcaccggtgtgggtgtcgcgaccgcggcgagcgcaccccggttgagcgcg
gacgcgcaggccgaggccgcggcgacacaggcgctgcgtgggctgacgctcgagcagaag
gtcgggcagctgttcgtcacctgggtgaacggcaagtccgccgacgaggtccacccgaag
aaccagaccgacttcggcgtcgacacccccgcgcaggtcatcgagaagtaccacctcggc
ggggtcatctacttcaacaacgactcgcgcgacaacttcgacgaccccgtgcaggtcgcg
aagctgtccaacggcctccaacaggccgccgtccggagcggggcgcacatccccctgcag
atcgccgccgaccaggagggcggcacggtcacgcggatgggcgcaccggccaccgagttc
ccgaacgccatggccgtctccgccgggcgggacacaaaccgcgcgacgcaagcggcgacc
atcctcggccgcgaactgcgggccgtcgggatcaaccaggacttcgcgcccgattcggac
gtcaactccaaccccgtcaacccggtcatcggcgtgcggtccttctccgggcagcccggc
ctggccagcgacttcgtcaccgccgagatcaagggcttccaggactccggcttcccgacc
aagaccgtggcggcgacggccaagcacttccccgggcacggtgccgcaccgaccgacagc
cacaccgggctgccgcggatcgacagcaccgaggcgcagtggcgggccaccgacgtgccg
ccgttcaaggccgcgatcgcggccggcgtcgactcgatcatgagcgcgcacatccagttc
cccagcctcgacccctcgctcgagcccgcgacgctgtcacagccgatcatcaccggccgg
ctgcgcaacgagctcggctaccgcggcgtcgtgatcaccgactccctcgagatggagggc
gtgcgcaggctgcacagcgacgccgagatcccggtgctcgcgctcaaggcgggcgtcgac
cagctgctcatgccggtgcacctcgagctcgccatcaactcggtcatcgccgccgtcaag
tccggcgacatcccgatgcggcggatcgaccagagcgtgctgcgcgtgctcaaactcaag
ttcctgcgcggcatcctcttctcgccgttcgtcgacaccggccgggtgatgaagaccgtc
ggcatcccgtcgagcctcgagaccgcgcaggacatcgccgaccgcggcatcacggccatc
gcgaacgacgccggtctcctgcccctgaagcagaagcccgcgacgacgctcgtcaccggc
tggggcgtctccacgacggcgaccctcgcgcagaagctgaccgcccacggcacggccgcg
acggcctaccaaaccggtcaggtcccgacggatgcccagatcgcgcaggccgtcgccaag
gcgcagagcgccgatctcgtcgtcgtgctgaccaacaacatcgccacctacccgctgcag
acgaacctgctcaacgcgctgcaggccaccgggaagccggttgtcgcggtcgccgcacag
atcccctacgacgcgggctacccgagcaccgtccggacctggctggccacctacggttac
atcacgccgaccctcgaggcgctggccaaggtgatcgtcggcgagacgaagccgatcggg
aagctgccggtggacatccccgcgggggccgacatgcagaccgtgaagtacccgttcggc
cacgggctgacctggtga

DBGET integrated database retrieval system