KEGG   Amycolatopsis mediterranei S699: AMES_8684Help
Entry
AMES_8684         CDS       T02190                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00010  Glycolysis / Gluconeogenesis
amm00620  Pyruvate metabolism
amm00640  Propanoate metabolism
amm00680  Methane metabolism
amm01100  Metabolic pathways
amm01110  Biosynthesis of secondary metabolites
amm01120  Microbial metabolism in diverse environments
amm01130  Biosynthesis of antibiotics
amm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMES_8684 (acs)
   00620 Pyruvate metabolism
    AMES_8684 (acs)
   00640 Propanoate metabolism
    AMES_8684 (acs)
  Energy metabolism
   00680 Methane metabolism
    AMES_8684 (acs)
Enzymes [BR:amm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AMES_8684 (acs)
Lipid biosynthesis proteins [BR:amm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AMES_8684 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFO82216
UniProt: G0G7K4
Position
9682949..9684931
Genome map
AA seq 660 aa AA seqDB search
MTEQSPALDNLLTESRTFPPSEDFAAQANAKADLYAEADADREAFWAKQAERLTWDTKWT
TVLDWTNAPFAKWFVGGKLNVAYNCVDRHVESGHGEQVAIHWVGEPGDTRDITYAELKTE
VSKAANALASLGVTAGDVVAIQLQMVPEAIFAMLACARIGALHNVVFGGFSPTALRARVD
DAAAKVVITSDGQFRRGKAAPMKANVDEALEGAETVEKVIVVKRTGDKLEGDVPWTDGRD
LWWHELVDGQSEEHTPKAFDSEHPLFILYTSGTTGKPKGILHTSGGYLTQTAYTHHNVFD
HKAGEDVYWCTADIGWITGHSYIVYGPLANRVTQVVYEGTPNTPHEGRHWEIIQKYKVSL
YYTAPTLIRTFMKWGAEIPEKYDLSSLRVLGSVGEPINPEAWIWYRENIGAGRTPIVDTW
WQTETGAIMISPLPGVTSTKPGSAQKALPGISAKVVDDQGNEVGPGGGGYLVLDKPWPSM
LRGVWGDEERFKDTYWSRFKDQGFYFAGDGAKYDNDGDIWLLGRVDDVMNVSGHRISTTE
VESALVSHPTVAEAAVVGATDPTTGQGIVAFVILRGNAVDGGEEAIQALRNHVAKEIGPI
AKPRQIMVVPELPKTRSGKIMRRLLRDVAENRQVGDVTTLADSSVMDLISSGLKSGKSEE
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcagtccccagccctggacaacctgctcaccgagagccgcaccttcccgccc
agcgaagatttcgctgctcaggccaacgcgaaggccgacctctacgccgaggcggacgcc
gaccgcgaagcgttctgggcgaagcaggccgagcggctcacgtgggacacgaagtggacc
acggtactggactggaccaatgcaccgttcgcgaagtggttcgtcggcggcaagctgaac
gtcgcctacaactgcgtcgaccggcacgtcgagtccgggcacggcgagcaggtcgcgatc
cactgggtcggcgagccgggtgacacccgggacatcacctacgccgagctgaagaccgag
gtttccaaggccgccaacgcactcgcgtcgctgggcgtcaccgccggcgacgtcgtggcg
atccagctgcagatggtccccgaggccattttcgcgatgctcgcgtgcgcgcggatcggc
gcgctgcacaacgtcgtcttcggcggcttctcgccgacggcgctgcgggcccgcgtcgac
gacgccgccgcgaaggtcgtgatcacctccgacggccagttccgccgcggcaaggccgcg
ccgatgaaggccaatgtcgacgaagcgctcgaaggcgccgaaaccgtcgagaaggtcatc
gtcgtgaagcgcacgggcgacaagctggagggcgacgtcccgtggaccgacggtcgcgac
ctgtggtggcacgagctcgtcgacggacagtccgaagagcacactcccaaagcgttcgac
agcgagcacccgctgttcatcctctacacgtccgggacgaccgggaagccgaagggcatc
ctgcacacctccggcggctacctgacgcagaccgcgtacacgcaccacaacgtcttcgac
cacaaggccggcgaagacgtctactggtgcaccgccgacatcggctggatcaccggccac
agctacatcgtctacggccccctcgccaaccgcgtcacgcaggtcgtctacgaaggcacg
ccgaacaccccgcacgaggggcggcactgggagatcatccagaagtacaaggtctccctc
tactacacggcgccgacgctgatccgcacgttcatgaagtggggcgcggaaatcccggag
aagtacgacctgtcgtcgctgcgggtgctgggctcggtcggcgagccgatcaaccccgag
gcgtggatctggtaccgcgagaacatcggcgccggccggaccccgatcgtcgacacgtgg
tggcagaccgaaaccggcgcgatcatgatctcgccgctgccgggcgtcacctcgaccaag
ccgggctcggcgcagaaggcgctgccgggcatctccgcgaaggtcgtcgacgaccagggc
aacgaggtcggcccgggcggcggcgggtacctggtgctcgacaagccgtggccgtcgatg
ctgcgcggggtctggggcgacgaggagcgcttcaaggacacctactggtcgcggttcaag
gaccagggcttctacttcgccggcgacggcgcgaagtacgacaacgacggcgacatctgg
ctgctgggccgcgtcgacgacgtcatgaacgtgtccggccaccgcatctcgacgaccgag
gtcgagtcggcgctggtctcgcacccgacggtcgccgaggccgcggtcgtcggcgcgacc
gacccgacgaccggccagggcatcgtcgcgttcgtcatcctgcgcggcaacgccgtcgac
ggtggcgaagaggcgatccaggcgctgcggaaccacgtcgcgaaggagatcgggccgatc
gcgaagccgcggcagatcatggtcgtgccggagctgccgaagacgcgttcgggcaagatc
atgcgccgcctgctgcgcgacgtcgcggagaaccggcaggtcggcgacgtcaccacgctg
gccgactcgtcggtgatggacctgatctcgtcgggcctgaagtcgggcaagtcggaggag
tga

DBGET integrated database retrieval system