KEGG   Amycolatopsis mediterranei S699: AMES_8819Help
Entry
AMES_8819         CDS       T02190                                 

Definition
limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:amm00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9820669..9821094)
Genome map
AA seq 141 aa AA seqDB search
MVTGFLKALEDLDIDRALTFAASDIVYQNVPLPPARGVAAVEKQLRLMARFGSGFEARTH
HIASDGNVVLTERTDVLRRGAWEAEFWVCGTFEVEGGRIVLWRDYFDWTTVLAASAKGAG
RVALAGARTLLDRYKGRQAVR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaccggtttcctgaaagcgctcgaagacctcgacatcgaccgcgcgctgacgttc
gcggcgagcgacatcgtgtaccagaacgtgccgttgccgcccgctcgcggcgtcgccgcg
gtcgagaagcagctgcgtctgatggcccgcttcggttccgggttcgaagcgcggacgcac
cacatcgcctcggacggcaacgtcgtgctcaccgaacgcaccgacgtgctgcgccgcggc
gcgtgggaagcggagttctgggtgtgcggcacgttcgaggtcgaaggcggccggatcgtg
ctctggcgcgactacttcgactggacgacggtgctggccgcgagcgcgaagggcgccggg
cgggtcgcgctggccggcgcgcgcacgctcctcgaccggtacaaggggaggcaggcggtg
cgctag

DBGET integrated database retrieval system