KEGG   Amycolatopsis mediterranei S699: RAM_00660Help
Entry
RAM_00660         CDS       T01822                                 

Definition
DNA-formamidopyrimidine glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:amn03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
139578..140438
Genome map
AA seq 286 aa AA seqDB search
MPELPEVEALAHHLRENAVGRTIFRIDVASLSVLKTATPPWTELHGREITGATRHGKHLD
VVAGDLHLVVHLARAGWLRWSDGLAAAPLKPGKGPISLRVHLESATGPGFDLTEAGTKKG
LAVWVVKDPQEIASVARLGPDALAVDAAQLRELFAGKNTRLKWALTDQSLLAGIGNAYSD
EIMHRAKLSPYATIGKLDEGALETLAEAIHDIETDAVERSVGQKAARLKGEKRSGLRVHA
RTGLPCPVCGDTIREISFADKSFQYCPTCQTGGKPLADRRMSRLLK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctacccgaggtcgaagcactggctcaccacctgcgcgagaacgccgtgggc
cggacgatcttccgcatcgatgtcgcatcgctgagcgtcttgaagacggccaccccgccg
tggaccgagctgcacggccgcgagatcaccggcgcgacccggcacggcaagcacctcgac
gtcgtggccggtgacctgcacctggtcgtccacctggcgcgggcgggctggctgcgctgg
tccgacggtctcgccgcggccccgctgaagccgggcaagggcccgatctcgctgcgggtg
cacctcgagtccgccaccgggccgggcttcgacctcaccgaagcgggcacgaagaagggc
ttggcggtgtgggtcgtcaaggacccgcaggagatcgcgagcgtggcgcggctgggtccg
gacgcgctcgccgtggacgccgcccagctgcgtgagctgttcgccggcaagaacacccgg
ctgaagtgggcgctcaccgaccagtcgctcctcgccgggatcggcaacgcctactccgac
gagatcatgcaccgcgcgaagctctcgccgtacgccacgatcggcaagctcgacgagggg
gccctggagacgctcgccgaggcgatccacgacatcgagaccgacgccgtcgagcggtcg
gtggggcagaaggcggcccggctgaagggggagaagcggtcgggcctgcgggtccacgcg
cgcaccgggctgccgtgccccgtctgcggcgacacgatccgcgaaatatccttcgccgac
aagtcgttccagtactgcccgacctgccagacgggcggcaagccgctcgccgaccgccgg
atgtcgcggctgctgaagtag

DBGET integrated database retrieval system