KEGG   Amycolatopsis mediterranei S699: RAM_02115Help
Entry
RAM_02115         CDS       T01822                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RAM_02115
Enzymes [BR:amn01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     RAM_02115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
420343..421371
Genome map
AA seq 342 aa AA seqDB search
MTFDFAGFPDAALAAVPRVDLGGWPTPLHGAPRLGEALGLRNLWLKRDDVHPLGAGGNKL
RKLEYHLGAAEKAGADTVITFGALQTNHGRQTAAACAKLGLRCELVLTAKVPRDGEAYER
GGNLPLDRLFGATVHICADGEETGRTYDRLVAEAAADGRKVATIPVGGSNDLGALGYVRA
TYELAKQLEERGIERAHLVVPHASGGTAAGVALGTALLGNLGVGIACVSHPLDEATENLR
DLVDGAAKLLGVEPPSLTHTRMGDSTLGPGYGIPTDAVWNALRLFGRTEGVVLDPVYTGK
VAAALVEWAGHFAPDDHVVFLHTGGMPGLYGYAPEFAAAVEG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcgacttcgccggattccccgacgccgcgctggccgcggtaccccgcgtcgac
ctgggcggctggccgacgccgctgcacggggccccccggctcggcgaagccctcggcctg
cggaacctctggctcaagcgcgacgacgtgcacccgctcggcgccggcggcaacaagctc
cgcaagctggagtaccacctcggcgcggcggaaaaagccggtgcggacaccgtgatcacc
ttcggggcgctccagaccaaccacggccgtcagaccgccgccgcgtgcgcgaagctcggc
ctgcgctgcgagctcgtgctcacggccaaggtcccgcgcgacggcgaggcgtacgaacgc
ggcggcaacctgcccctcgaccggcttttcggcgcgaccgtccacatctgcgccgacggc
gaggaaaccggccgcacctacgaccgcctggtcgccgaagccgccgccgacggccggaag
gtcgccacgatcccggtcggcggctccaacgacctcggcgccctcgggtacgtccgcgcc
acctacgaactcgcgaaacagctggaagagcgcggcatcgagcgggcacacctcgtcgtc
ccgcacgccagcggcggcaccgcggccggcgtcgcgctgggcaccgcgctcctaggcaac
ctcggcgtcggcatcgcctgcgtcagccacccgctcgacgaggccacggagaacctccgc
gacctcgtcgacggcgcggccaagctcctcggcgtcgaaccaccgtcgctcacgcacacg
aggatgggcgattccacgctcggccccggttacggcatcccgaccgacgcggtctggaac
gccctacggctcttcggtcgcaccgagggcgtggtgctcgacccggtctacaccggcaag
gtggccgccgcgctggtcgaatgggccggccacttcgccccggacgaccacgtggtgttc
ctgcacaccggcggcatgcccggcctgtacggctacgcgcccgaattcgccgcggccgtc
gaaggctga

DBGET integrated database retrieval system