KEGG   Amycolatopsis mediterranei S699: RAM_02115Help
Entry
RAM_02115         CDS       T01822                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Organism
amn  Amycolatopsis mediterranei S699
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
420343..421371
Genome map
AA seq 342 aa AA seqDB search
MTFDFAGFPDAALAAVPRVDLGGWPTPLHGAPRLGEALGLRNLWLKRDDVHPLGAGGNKL
RKLEYHLGAAEKAGADTVITFGALQTNHGRQTAAACAKLGLRCELVLTAKVPRDGEAYER
GGNLPLDRLFGATVHICADGEETGRTYDRLVAEAAADGRKVATIPVGGSNDLGALGYVRA
TYELAKQLEERGIERAHLVVPHASGGTAAGVALGTALLGNLGVGIACVSHPLDEATENLR
DLVDGAAKLLGVEPPSLTHTRMGDSTLGPGYGIPTDAVWNALRLFGRTEGVVLDPVYTGK
VAAALVEWAGHFAPDDHVVFLHTGGMPGLYGYAPEFAAAVEG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcgacttcgccggattccccgacgccgcgctggccgcggtaccccgcgtcgac
ctgggcggctggccgacgccgctgcacggggccccccggctcggcgaagccctcggcctg
cggaacctctggctcaagcgcgacgacgtgcacccgctcggcgccggcggcaacaagctc
cgcaagctggagtaccacctcggcgcggcggaaaaagccggtgcggacaccgtgatcacc
ttcggggcgctccagaccaaccacggccgtcagaccgccgccgcgtgcgcgaagctcggc
ctgcgctgcgagctcgtgctcacggccaaggtcccgcgcgacggcgaggcgtacgaacgc
ggcggcaacctgcccctcgaccggcttttcggcgcgaccgtccacatctgcgccgacggc
gaggaaaccggccgcacctacgaccgcctggtcgccgaagccgccgccgacggccggaag
gtcgccacgatcccggtcggcggctccaacgacctcggcgccctcgggtacgtccgcgcc
acctacgaactcgcgaaacagctggaagagcgcggcatcgagcgggcacacctcgtcgtc
ccgcacgccagcggcggcaccgcggccggcgtcgcgctgggcaccgcgctcctaggcaac
ctcggcgtcggcatcgcctgcgtcagccacccgctcgacgaggccacggagaacctccgc
gacctcgtcgacggcgcggccaagctcctcggcgtcgaaccaccgtcgctcacgcacacg
aggatgggcgattccacgctcggccccggttacggcatcccgaccgacgcggtctggaac
gccctacggctcttcggtcgcaccgagggcgtggtgctcgacccggtctacaccggcaag
gtggccgccgcgctggtcgaatgggccggccacttcgccccggacgaccacgtggtgttc
ctgcacaccggcggcatgcccggcctgtacggctacgcgcccgaattcgccgcggccgtc
gaaggctga

DBGET integrated database retrieval system