KEGG   Amycolatopsis mediterranei S699: RAM_02345Help
Entry
RAM_02345         CDS       T01822                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RAM_02345
   01230 Biosynthesis of amino acids
    RAM_02345
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RAM_02345
  Energy metabolism
   00680 Methane metabolism
    RAM_02345
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RAM_02345
Enzymes [BR:amn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RAM_02345
Exosome [BR:amn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RAM_02345
  Exosomal proteins of melanoma cells
   RAM_02345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
459803..460552
Genome map
AA seq 249 aa AA seqDB search
MGEIGTLVLLRHGQSTWNAENLFTGWVDVPLSEQGEGEARQGGRLLADAGLLPDVVHTSL
LRRAISTANIALDAADRHWIPVKRDWRLNERHYGALQGKDKKQTLAEFGEEQFMLWRRSY
DTPPPPIDPQDEWSQVGDPRYAGLGDQAPLTECLKDVVERLLPYWESEIVPDLRAGKTVL
VAAHGNSLRALVKHLDGISDADIAGLNIPTGIPLRYDLTEDLQPVKPGGEYLDPDAAKEA
AAAVANQGR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagatcgggacgttggtgctgctgcggcacgggcagagcacgtggaacgcggaa
aacctgttcaccggctgggtggacgtaccgctttcggagcagggcgagggcgaagcccgc
cagggcggccggctgctggccgacgccgggctgctcccggacgtggtgcacacctcgctg
ctgcgccgcgcgatctccaccgcgaacatcgcgctggacgccgccgaccggcattggatc
ccggtgaagcgcgactggcgcctcaacgagcgccactacggcgcgctgcagggcaaggac
aagaagcagaccctcgccgagttcggcgaggagcagttcatgctctggcgccgctcgtac
gacaccccgccgccgccgatcgacccgcaggacgagtggagccaggttggcgacccccgc
tacgccggcctcggcgaccaggcgccgctgaccgagtgcctgaaggacgtcgtcgagcgg
ctgctgccgtactgggagtccgaaatcgtgccggacctccgcgcgggcaagaccgtgctg
gtcgccgcgcacggcaactcgctgcgcgcgctggtcaagcacctcgacggcatctccgac
gccgacatcgcgggcctgaacatcccgaccggcatcccgctgcgctacgacctcaccgag
gacctgcagccggtgaagccgggtggcgagtacctcgaccccgacgccgctaaggaagcc
gccgccgcggtggcgaaccagggccgctga

DBGET integrated database retrieval system