KEGG   Amycolatopsis mediterranei S699: RAM_02490Help
Entry
RAM_02490         CDS       T01822                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RAM_02490
Enzymes [BR:amn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RAM_02490
Exosome [BR:amn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RAM_02490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
489813..490739
Genome map
AA seq 308 aa AA seqDB search
MRRLVGETTLRPRQLILPMFVAEGIDSPRPISSMPGVVQHTRDTLRKAAVDAVNAGVGGL
MLFGIPATRDAEGSGAVDEKGILNVALRDLRHELGDATVLMADTCLDEFTDHGHCGVLDA
DGGVDNDATLRIYAQMAIAQVEAGAHVLGPSGMMDGQIGVIRRALDEVGHKEAAILAYSA
KYASAFYGPFREAVDSQLKGDRKTYQQDPGNGREALREIELDLAEGADMIMVKPALAYLD
VIKAAADISPVPVAAYNISGEYAMVEAAAANGWLDRERTVLEVLTSIRRAGADLILSYWA
AEAAAWLD
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggctggtgggcgaaacgacgctgcggccacgccagctgatcctcccgatgttc
gtcgccgaagggatcgactcgccgcggccgatttcgagcatgcccggcgtcgtccagcac
acccgcgacacgctgcggaaggccgccgtcgacgcggtcaacgccggcgtcggtggcctc
atgctgttcggcatcccggccacgcgcgacgccgagggctccggagccgtcgacgaaaag
ggcatcctcaacgtggccctgcgcgacctccgccacgagctgggtgacgccaccgtgctg
atggccgacacctgcctcgacgagttcaccgaccacggccactgcggcgtcctcgacgcc
gacggcggggtcgacaacgacgccaccctgcggatctacgcccagatggccatcgcgcag
gtcgaagccggggcgcacgtgctcgggccgtccgggatgatggacggccagatcggtgtc
atccgccgggcgctcgacgaggtcgggcacaaggaggcggcgatcctggcgtactccgcg
aagtacgccagcgcgttctacggccccttccgcgaggccgtcgactcgcagctcaagggc
gaccgcaagacctaccagcaggacccgggcaacggccgcgaggcgctgcgcgagatcgag
ctggacctcgccgagggcgcggacatgatcatggtcaagcccgcgctggcctacctggac
gtcatcaaggcggccgcggacatctccccggtgccggtggcggcctacaacatctcgggc
gagtacgcgatggtcgaggccgcggcggcgaacggctggctggaccgcgagcggacggtt
ctcgaggtgctgacgtcgatccgccgcgcgggcgccgacctgatcctgagctactgggcc
gcggaggccgctgcctggctggactga

DBGET integrated database retrieval system