KEGG   Amycolatopsis mediterranei S699: RAM_02780Help
Entry
RAM_02780         CDS       T01822                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00071  Fatty acid degradation
amn00280  Valine, leucine and isoleucine degradation
amn00281  Geraniol degradation
amn00310  Lysine degradation
amn00360  Phenylalanine metabolism
amn00362  Benzoate degradation
amn00380  Tryptophan metabolism
amn00410  beta-Alanine metabolism
amn00627  Aminobenzoate degradation
amn00640  Propanoate metabolism
amn00650  Butanoate metabolism
amn00903  Limonene and pinene degradation
amn00930  Caprolactam degradation
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01120  Microbial metabolism in diverse environments
amn01130  Biosynthesis of antibiotics
amn01212  Fatty acid metabolism
Module
amn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RAM_02780
   00650 Butanoate metabolism
    RAM_02780
  Lipid metabolism
   00071 Fatty acid degradation
    RAM_02780
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RAM_02780
   00310 Lysine degradation
    RAM_02780
   00360 Phenylalanine metabolism
    RAM_02780
   00380 Tryptophan metabolism
    RAM_02780
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RAM_02780
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RAM_02780
   00281 Geraniol degradation
    RAM_02780
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RAM_02780
   00627 Aminobenzoate degradation
    RAM_02780
   00930 Caprolactam degradation
    RAM_02780
Enzymes [BR:amn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RAM_02780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 DLH
Motif
Other DBs
NCBI-ProteinID: AEK39048
UniProt: G0FP69
Position
complement(547195..547959)
Genome map
AA seq 254 aa AA seqDB search
MTDRIVSEHSGGVALLTVDAPASRNALTLDLSAQLAAAVEAAERDESVHAVVVTGTPPVF
CAGADLSALAAADEPGLRAIYEGFLAVARCELPTIAAVGGAAVGAGLNLALAADVRLAGP
RAKFVARFLELGLHPGGGMTWMTQRLAGPQQAAAMTLFGQPLDAEAAVRAGLALRVVDGG
HDELLTAARELAHPAVAAPREALVATKRSLRATASLAEHSAAVDVEIRPQLASLASPEFA
QRLSLLQDRIRSRP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcatcgtcagcgagcactccggcggcgtcgccctgctgaccgtcgacgcg
cccgccagccggaacgcgctgacgctcgacctctccgcgcagctcgccgccgccgtcgag
gccgcggagcgggacgagtccgtgcacgccgtcgtggtcaccgggacgccgcccgtcttc
tgcgccggcgccgacctgtccgcgctcgccgcggccgacgagcccggcttgcgggccatc
tacgaaggcttcctcgccgtcgcgcggtgcgagctgccgaccatcgccgcggtcggaggt
gccgccgtcggggccgggctgaacctcgccctcgccgccgacgtccggctggccgggccg
cgggcgaagttcgtcgcccggttcctcgagctcgggctgcacccgggcggcgggatgacc
tggatgacgcagcggctcgccggcccgcagcaggccgccgccatgacgttgttcgggcag
ccgctcgacgccgaagccgcggtgcgcgccgggctggcgctgcgcgtggtcgacggcggc
catgacgaactactgaccgcggcgcgtgagctcgctcaccccgcggtggccgcgccgcgc
gaagcactggtcgccaccaagcgcagtctccgcgccaccgcgagcctggccgagcacagt
gccgccgtcgacgtcgagatccggccgcagctggcctcgctggcgtcaccggagttcgcc
cagcggctttccctgctgcaggaccggatccgttctcggccgtga

DBGET integrated database retrieval system