KEGG   Amycolatopsis mediterranei S699: RAM_03270Help
Entry
RAM_03270         CDS       T01822                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:amn00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:amn00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
698641..699285
Genome map
AA seq 214 aa AA seqDB search
MGSVSTRSMTVQPLAIDGAHVVTSQSFGDERGDFFEVYRQDVLTEALGYRPRFLQTNVST
SCRNVVRGVHGAMTPPGLAKFVTCLRGSLLDFVVDVRTGSPTFGQWDMIVLNQHGGTAVY
VEEGLGHAFVSLEDDTCVQYLLSDLYRPAEVLTVQPLDPEIGLPLNLPGEPILSERDAAA
PTLREAGELGLLPRYEECLALREARVRLEVSVAS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcgtcagcacccgcagcatgaccgttcagccgctggccatcgacggcgcacac
gtggtcacgtcccagtcgttcggcgacgagcgcggcgacttcttcgaggtctaccgccag
gacgtgctcaccgaggcgctcggctaccggccgcggttcctgcaaacgaacgtctcgacg
tcgtgccgcaacgtcgtgcgcggcgtgcacggggcgatgaccccgcccggcctggcgaag
ttcgtgacgtgcctgcgcggttcgctgctcgacttcgtcgtcgacgtgcggaccggttcc
ccgacgttcggccagtgggacatgatcgtgctcaaccagcacggcgggaccgcggtgtac
gtcgaggaaggcctcggccacgcgttcgtgtccctcgaagacgacacgtgcgtccagtac
ctgctgtccgacctctaccggccggcggaggtgctcaccgtgcagccgctggacccggaa
atcggcctcccgctgaacctgccgggcgagccgatcctgtccgagcgcgacgcggcggcg
ccgacgttgcgggaggccggcgagctgggcctgctgccgcggtacgaggagtgcctcgcg
ctgcgggaggcgcgcgtgcggctcgaagtgtccgtggcttcctga

DBGET integrated database retrieval system