KEGG   Amycolatopsis mediterranei S699: RAM_04390Help
Entry
RAM_04390         CDS       T01822                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:amn00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
919550..920827
Genome map
AA seq 425 aa AA seqDB search
MSAFAAVDVIRTKRDGGTLSDEQIDWVVDAYTRGDVAEEQMSALAMAIFLRGMTSAEISR
WTHAMIASGERLSLSVSRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTG
GTLDKLESIPGWRAALSTSEIQSQLEDVGAVVCAATSGLAPADKKLYALRDVTSTVESIP
LIASSIMSKKIAEGASGLVLDVKFGSGAFMKSLDQARSLASALTSIGADHGVPTTALLTD
MNVPLGRAVGNAVEVAESVDVLKGGGPADVVALTVALAREMLALAGLDVDPAAVLASGEA
YEVWCRMIAAQGGDPSAPLPTPSHVHVVTAPSSGVLASLDAYAVGVAAWRLGAGRARKED
PVQAAAGILCLAKPGDAVSEGDPLLELHTDTPDAVPAALSALEGGFTIASSAPEPGPIVV
ETIRS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgttcgcggcggtcgacgtcatccggaccaagcgggacggcggcacgctttcc
gacgagcagatcgactgggtcgtcgacgcctacacccggggtgacgtcgccgaagagcag
atgtcggcgctggccatggcgatcttcctgcgcgggatgacctcggccgagatctcccgg
tggacgcacgcgatgatcgcgtcgggggagcggctgtcgctttcggtgtcccggccgacg
gtggacaagcactcgacgggcggggtcggcgacaagatcacgctgccgctggcgccgctg
gtggcggcgtgcggcgcggccgtgccacagctgtccggccgcgggctcggccacaccggc
gggacgctcgacaagctggagtcgattcccggctggcgcgccgcactgtccacttcggag
attcaatcgcagctggaggacgtcggcgcggtggtctgcgcggcgacgtccgggctggcg
ccggcggacaagaagctgtacgcgctgcgggacgtcacgtccactgtggagtcgatcccg
ctgatcgccagctcgatcatgagcaagaagatcgccgaaggcgcgtccgggctggtcctg
gacgtgaagttcgggtcgggcgcgttcatgaagtcgcttgaccaggctcgttcgctggct
tccgcgttgacctcgatcggcgccgatcacggtgtcccgacgacggcgttgctgaccgac
atgaacgtcccgctggggcgggcggtcggcaacgcggtggaggtcgcggagtcggtcgac
gtgctcaaaggcggcggtccggcggacgtggtcgcgctgactgtggccctggcccgggag
atgctggcgctggccggcctcgacgtcgacccggcggcggtgctggcttcgggcgaggcg
tacgaggtctggtgccggatgatcgcggcccagggcggcgacccgtcggcgccgctgccg
acgccctctcacgtccacgtggtcacggcgccttcttcgggggtgctggcttcgctggac
gcgtacgcggtgggcgtcgcggcgtggcggctcggtgcgggccgcgcccgcaaggaggac
ccggtccaggccgcggcgggcatcctgtgcctggccaagccgggggacgcggtctccgag
ggcgacccgctgctggaactccacacggacacgcctgacgcggtcccggccgccctgtcc
gcgctcgagggtgggttcacgatcgcttcgtcggcgcctgaaccgggcccgatcgtcgtg
gagaccatccgtagctag

DBGET integrated database retrieval system