KEGG   Amycolatopsis mediterranei S699: RAM_05255Help
Entry
RAM_05255         CDS       T01822                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amn01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:amn00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1088086..1089156
Genome map
AA seq 356 aa AA seqDB search
MSLDLHADPVDLTTALVDIFSVSGAEAEIATAVQEALQAQAPHLEVVRNGDAVLARTDLG
RGSRVVLAGHLDTVPENGNLPSRREGTGDEEILHGLGTVDMKGGDAVFLHLAATLPSPKH
DITFVFYDNEEVEAVKNGLGRIERELPEWLAGDLAIVGEPSNGVIEAGCQGTMRVELRLS
GKRAHTARAWMGENAIHALAEPLRRLAEYTPRIVDIDGLTYREGLQATSISGGVAGNVVP
DAAVLTVNHRFAPDRDPAAAERHLREVFDGFELSVVDLSPGALPGLSAPAAAELVTAAGG
RAAAKLGWTDVARFAARGMPAVNFGPGNPTLAHTKQENVRTAEIRQVTEVLRKFLA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgacctgcacgccgacccggtggacctgaccacagcgctggtggacatcttc
agcgtgtccggcgccgaggccgagatcgccaccgcggtgcaggaggcgctgcaggcgcag
gcgccgcacctcgaggtcgtccgcaacggcgacgccgtcctggcgcggaccgacctcggc
cgcgggtcgcgggtcgtgctcgccgggcacctggacaccgtgccggagaacggcaacctg
ccttcccggcgcgaaggcaccggtgacgaagagatcctgcacggcctcggcacggtcgac
atgaaaggtggcgacgcggtcttcctgcacttggcggcgacgctgccttcgcccaagcac
gacatcaccttcgtcttctacgacaacgaagaggtcgaagcggtcaagaacggcctcggc
cggatcgagcgcgagctgccggagtggctggccggcgacctggcgatcgtcggcgagccg
tcgaacggcgtgatcgaggccggctgccagggcaccatgcgcgtcgagctgcggctctcg
gggaagcgggcgcacaccgcgcgggcgtggatgggcgagaacgcgatccacgcgctcgcc
gagccgctgcgccggctggcggagtacacgccgcggatcgtcgacatcgacgggctgacc
taccgcgagggtctccaggcgacgtcgatcagcggcggtgtggcgggcaacgtcgtcccg
gacgcggcggtgctgacggtgaaccaccgcttcgccccggaccgcgacccggcggcggcc
gagcggcacctgcgcgaggttttcgacggtttcgaactgtccgttgtggacctttccccg
ggagcgctgccgggcctgtcggccccggcggcggcggaactggtgacggcggcgggcggc
cgcgcggcggccaagctgggctggacggacgtggcccgcttcgcggcgcgcggcatgccg
gcggtgaacttcggcccgggcaacccgacgctggcgcacacgaagcaggagaacgtccgg
acggcggagatccgccaggtcaccgaggtgctccgcaagttcctggcctga

DBGET integrated database retrieval system