KEGG   Amycolatopsis mediterranei S699: RAM_05745Help
Entry
RAM_05745         CDS       T01822                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:amn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1188694..1189503
Genome map
AA seq 269 aa AA seqDB search
MGELSGTAIGVTAERRAGEFIAALERYGAEVRHAPTITIVPLDADPELRAGTEATLAAPV
GFTVVTTGAGFRGWLDAAEGWELRDRLVAALGESRIYARGPKAVGAVRGAGLRESFSAAS
ESNAELFGALAAAGVRGERVAVQLHGTPLPELTDPLVRAGASLVQVQPYRWHSPPDVTPV
HDLIAAIVAGELDALAFTSAPAAANFLTLARTSGRYDELLAALRGPLVCACVGPVTAAPL
EAAGIETLQPDRQRLGALVKLLVTTLGTG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagctgagcggcaccgcgatcggcgtgacggccgagcgccgggccggcgaattc
atcgccgccctcgaacgctacggcgccgaggtccggcacgccccgacgatcaccatcgtg
ccgctggatgccgaccccgagctgcgcgcgggcaccgaagccacgctggcggccccggtc
gggttcacggtggtcacgacgggggcgggcttccgcggctggctcgacgcggccgaaggc
tgggagctgcgtgatcggctcgtggcagcgctgggggaatcccggatctacgcccgcggc
ccgaaggcggtgggcgcggtccgcggtgccggcctgcgcgagtccttttcggccgcctcg
gagagcaacgcggaactgttcggagcgctggccgcggccggggtccgtggcgagcgggtg
gccgtccagctgcacgggacgccgctgccggagctcaccgatccgctggtgcgggccggc
gcctccctggtgcaggtgcagccgtaccgctggcattcgccgccggacgtgacgcccgtg
cacgacctgatcgccgcgatcgtggcaggcgaactggacgcgttggccttcacgagcgcc
ccggccgcggcgaacttcctgacgctggctcgcacgtccggccgctacgacgagctgctg
gcggcgctgcgcggcccgctggtgtgcgcgtgcgtcggcccggtgaccgcggcccccctg
gaggcggcgggcatcgagacgctgcagccggaccgccagcgcctgggcgcgctggtgaaa
ctgctggtcacaacgctcggcacggggtag

DBGET integrated database retrieval system