KEGG   Amycolatopsis mediterranei S699: RAM_08320Help
Entry
RAM_08320         CDS       T01822                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RAM_08320
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RAM_08320
Enzymes [BR:amn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RAM_08320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1750233..1751513
Genome map
AA seq 426 aa AA seqDB search
MTEQAKQAAAELAAQWANDPRWAGVQRSYSAEDVIKLRGSVVEEHTLARRGAEKLWDLLH
TEDYIHALGALTGNQAVQQVRAGLQAIYLSGWQVAADANLSGQTYPDQSLYPANSVPAVV
RRINNALGRADQINWAEGNTDIDWYAPIVADAEAGFGGPLNAFELMKGMIAAGAAGVHWE
DQLASEKKCGHLGGKVLIPTKQHERTLNAARLASDVLNVPTLVVARTDAQAATLLTSDVD
ERDRQFLTGGRTAEGFYEVTNGIEPCIERGLAYAQYADLLWMETSEPDLEVARKYAEAIK
AKFPDQMLAYNCSPSFNWKKHLDDATIAKFQRELGHMGYKFQFITLAGFHALNYSMFDLA
HGYAREGMTAYVDLQEREFASESRGYTATKHQREVGTGYFDNVATALNPESSTTALKGST
EEAQFH
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacaggccaagcaggcggccgcggagctggcggcgcagtgggcgaacgacccc
cgctgggcgggcgtgcagcgctcctactcggccgaagacgtgatcaagctgcgcggcagc
gtcgtcgaggagcacaccctggcccgccgcggggcggagaagctgtgggacctgctgcac
accgaggactacatccacgcgctcggggcgctcaccggcaaccaggccgtccagcaggtc
cgcgccggcctgcaggcgatctacctgtccggctggcaggtcgcggccgacgccaacctg
tccggccagacctaccccgaccagagcctctacccggccaactcggtgccggccgtggtc
cgccgcatcaacaacgcgctgggccgcgccgaccagatcaactgggccgaaggcaacacc
gacatcgactggtacgccccgatcgtcgccgacgccgaggccggcttcggtggcccgctc
aacgcgttcgagctgatgaagggcatgatcgccgccggcgccgcgggtgtgcactgggag
gaccagctcgcgtccgagaagaagtgtggtcacctcggcggcaaggtcctcatcccgacc
aagcagcacgagcgcacgctgaacgccgcccgcctcgcgtccgacgtgctgaacgtgccg
accttggtcgtcgcccgcaccgacgcgcaggccgcgacgctgctgaccagcgacgtcgac
gagcgcgaccggcagttcctcaccggcggccgcaccgccgagggcttctacgaggtcacc
aacggcatcgagccctgcatcgagcgcggcctggcctacgcccagtacgccgacctgctc
tggatggagacctccgagccggacctcgaggtggcgcgcaagtatgccgaggccatcaag
gcgaagttcccggaccagatgctggcctacaactgctcgccgtcgttcaactggaagaag
cacctggacgacgcgacgatcgcgaagttccagcgcgagctcggccacatgggctacaag
ttccagttcatcacgctggccggcttccacgcgctgaactactcgatgttcgacctggcg
cacggctacgcccgcgagggcatgaccgcctacgtcgacctgcaggagcgcgagttcgcg
tcggagagccgcggctacaccgcgaccaagcaccagcgcgaggtcggcaccggctacttc
gacaacgtcgcgacggcgctgaacccggagagctcgaccaccgcgctcaagggctccacc
gaagaagcccagttccactga

DBGET integrated database retrieval system