KEGG   Amycolatopsis mediterranei S699: RAM_08325Help
Entry
RAM_08325         CDS       T01822                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:amn01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:amn00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:amn00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1751609..1753216
Genome map
AA seq 535 aa AA seqDB search
MVDRLNYRIEVTGPVEGRFAEILTPAALDFLAKLDNTFAGRRRELLDARRVRREELQSGE
KPLGFLPETRSIRDDESWHVAPTAPGLEDRRVEITGPTDRKMTVNALNSGAKVWLADFED
ATSPTWHNVIDGQLNLYDAIRRNIDFTTDAGKRYTIGDEPATIVARPRGWHLVEKHIRID
GRPVSASLVDFGLFVFHNARQLVARGVGPYFYLPKLENHLEARLWNDVFLLAQRELGIPR
GTIRATVLIETITAAFEMDEILYELREHAAGLNAGRWDYIFSMIKNFAAHGADFVLPDRA
QVTMTVPFMRAYTELLVRTCHRRRAHAIGGMAAFIPSKDPEINATAIEKVRADKEREAGD
GFDGSWVAHPGLVPVCREVFDGVLGGWPNQLGKLREDVHVTAEDLLDVASAGGEVTEAGV
RANINVALRYVDAWLRGTGAAAIHHLMEDAATAEIARCQIWQWIRNGTKLEDGTALTREL
AVEFLDDELASVRAELGTGNRLDDAYEIFTETALGEKLPSFLTTGAYARYLTDAR
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggttgatcggctgaactaccgcatcgaggtcaccggcccggtcgagggccggttcgcg
gagatcctgaccccggcggcactcgacttcctggccaagctggacaacacgttcgccgga
cgccggcgcgagctgctcgacgcccgccgcgtgcggcgcgaagaactgcagtccggggag
aagccgctcggcttcctgcccgagacccggtcgatccgcgacgacgagtcgtggcacgtg
gctccgaccgcgccgggcctcgaggaccgccgcgtcgagatcaccggcccgaccgaccgc
aagatgacggtcaacgcgctgaactccggcgccaaggtctggctggcggacttcgaggac
gcgacgtcgccgacgtggcacaacgtcatcgacggccagctcaacctctacgacgccatc
cgccgcaacatcgacttcaccacggatgcgggtaagcgctacacgatcggcgacgagccc
gcaacgatcgtcgcgcggccccgcggctggcacctggtggagaagcacatccgcatcgac
ggccgcccggtctcggcgagcctggtcgacttcggcctgttcgtcttccacaacgcgcgc
cagctggtggcccgcggcgtgggcccgtacttctacctgccgaagctggaaaaccacctc
gaagcgcgcctgtggaacgacgtcttcctgctggcgcagcgcgagctcggcatcccgcgc
ggcaccatccgcgcgaccgtgctgatcgagacgatcaccgccgcgttcgagatggacgaa
atcctctacgagctgcgcgagcacgccgcggggttgaacgccggccgatgggactacatc
ttcagcatgatcaagaactttgccgcgcacggcgccgacttcgtcctgccggaccgcgcg
caggtgacgatgaccgtgccgttcatgcgggcctacaccgagctgctggtgcgcacctgc
caccggcgccgcgcgcacgccatcggcggcatggccgcgttcatcccgagcaaggacccg
gagatcaacgcgaccgcgatcgagaaggtccgcgcggacaaggaacgcgaggccggtgac
ggtttcgacggctcctgggtcgcgcaccccggcctggtcccggtctgccgcgaggtcttc
gacggcgtgctcggcggctggcccaaccaactcggcaagctgcgcgaagacgtccacgtc
accgccgaggacctgctcgacgtggccagcgccggcggcgaggtcaccgaggcgggcgtg
cgcgcgaacatcaacgtcgcgctgcgctacgtcgacgcgtggctgcgcggcaccggcgcg
gcggcgatccaccacctcatggaggacgcggccaccgcggagatcgcgcgctgccagatc
tggcagtggatccgcaacggcacgaagctcgaggacggcacggcgctgacccgcgaactg
gcggtcgaattcctggacgacgaactcgcgtcggtccgcgctgaactcggcaccggcaac
cgcctcgacgacgcgtacgagatcttcaccgaaaccgcgctgggcgagaagctgcccagc
ttcctcaccacgggtgcctacgcgcggtacctcacggacgcccggtag

DBGET integrated database retrieval system