KEGG   Amycolatopsis mediterranei S699: RAM_08325Help
Entry
RAM_08325         CDS       T01822                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RAM_08325
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RAM_08325
   00630 Glyoxylate and dicarboxylate metabolism
    RAM_08325
Enzymes [BR:amn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RAM_08325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1751609..1753216
Genome map
AA seq 535 aa AA seqDB search
MVDRLNYRIEVTGPVEGRFAEILTPAALDFLAKLDNTFAGRRRELLDARRVRREELQSGE
KPLGFLPETRSIRDDESWHVAPTAPGLEDRRVEITGPTDRKMTVNALNSGAKVWLADFED
ATSPTWHNVIDGQLNLYDAIRRNIDFTTDAGKRYTIGDEPATIVARPRGWHLVEKHIRID
GRPVSASLVDFGLFVFHNARQLVARGVGPYFYLPKLENHLEARLWNDVFLLAQRELGIPR
GTIRATVLIETITAAFEMDEILYELREHAAGLNAGRWDYIFSMIKNFAAHGADFVLPDRA
QVTMTVPFMRAYTELLVRTCHRRRAHAIGGMAAFIPSKDPEINATAIEKVRADKEREAGD
GFDGSWVAHPGLVPVCREVFDGVLGGWPNQLGKLREDVHVTAEDLLDVASAGGEVTEAGV
RANINVALRYVDAWLRGTGAAAIHHLMEDAATAEIARCQIWQWIRNGTKLEDGTALTREL
AVEFLDDELASVRAELGTGNRLDDAYEIFTETALGEKLPSFLTTGAYARYLTDAR
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggttgatcggctgaactaccgcatcgaggtcaccggcccggtcgagggccggttcgcg
gagatcctgaccccggcggcactcgacttcctggccaagctggacaacacgttcgccgga
cgccggcgcgagctgctcgacgcccgccgcgtgcggcgcgaagaactgcagtccggggag
aagccgctcggcttcctgcccgagacccggtcgatccgcgacgacgagtcgtggcacgtg
gctccgaccgcgccgggcctcgaggaccgccgcgtcgagatcaccggcccgaccgaccgc
aagatgacggtcaacgcgctgaactccggcgccaaggtctggctggcggacttcgaggac
gcgacgtcgccgacgtggcacaacgtcatcgacggccagctcaacctctacgacgccatc
cgccgcaacatcgacttcaccacggatgcgggtaagcgctacacgatcggcgacgagccc
gcaacgatcgtcgcgcggccccgcggctggcacctggtggagaagcacatccgcatcgac
ggccgcccggtctcggcgagcctggtcgacttcggcctgttcgtcttccacaacgcgcgc
cagctggtggcccgcggcgtgggcccgtacttctacctgccgaagctggaaaaccacctc
gaagcgcgcctgtggaacgacgtcttcctgctggcgcagcgcgagctcggcatcccgcgc
ggcaccatccgcgcgaccgtgctgatcgagacgatcaccgccgcgttcgagatggacgaa
atcctctacgagctgcgcgagcacgccgcggggttgaacgccggccgatgggactacatc
ttcagcatgatcaagaactttgccgcgcacggcgccgacttcgtcctgccggaccgcgcg
caggtgacgatgaccgtgccgttcatgcgggcctacaccgagctgctggtgcgcacctgc
caccggcgccgcgcgcacgccatcggcggcatggccgcgttcatcccgagcaaggacccg
gagatcaacgcgaccgcgatcgagaaggtccgcgcggacaaggaacgcgaggccggtgac
ggtttcgacggctcctgggtcgcgcaccccggcctggtcccggtctgccgcgaggtcttc
gacggcgtgctcggcggctggcccaaccaactcggcaagctgcgcgaagacgtccacgtc
accgccgaggacctgctcgacgtggccagcgccggcggcgaggtcaccgaggcgggcgtg
cgcgcgaacatcaacgtcgcgctgcgctacgtcgacgcgtggctgcgcggcaccggcgcg
gcggcgatccaccacctcatggaggacgcggccaccgcggagatcgcgcgctgccagatc
tggcagtggatccgcaacggcacgaagctcgaggacggcacggcgctgacccgcgaactg
gcggtcgaattcctggacgacgaactcgcgtcggtccgcgctgaactcggcaccggcaac
cgcctcgacgacgcgtacgagatcttcaccgaaaccgcgctgggcgagaagctgcccagc
ttcctcaccacgggtgcctacgcgcggtacctcacggacgcccggtag

DBGET integrated database retrieval system