KEGG   Amycolatopsis mediterranei S699: RAM_08870Help
Entry
RAM_08870         CDS       T01822                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RAM_08870
  Lipid metabolism
   00561 Glycerolipid metabolism
    RAM_08870
   00600 Sphingolipid metabolism
    RAM_08870
Enzymes [BR:amn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     RAM_08870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1875244..1876461)
Genome map
AA seq 405 aa AA seqDB search
MDHGIAANRNASTGSTGLVLLLVVLTWLLSLPAATHALANGLAGTPPMGWNSWNQVRCYD
LTEDVVKQAADALADTGLRDAGYHYVVVDDCWQAPTRAADGSLQPDPKRFPHGIADLADY
VHSRGLLFGIYAVPGSRTCAMANDAYPAAGIGSLGHERQDAETFDRWGVDYLKYDWCNAD
TVDGLDRKAAFEKMRDELAALPRPIVYAISEYGVSSPWTWARPVANLWRTTYDLVPTWDS
VLATIDQQAGVAAHSGSPGGWNDPDMLQVGNGTLTADEARAHFSVWAVLNAPLFAGTDPA
KLSDTDLATLGNAEAIAVDQDFAGSQGRQLDAGPGYQVWGKPLSGGGFAVVLLNTGSTTA
TVSAAIPGAWNVRDLWAHRETGTVVGTVSSTLRPHAAALLKLTPR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ttggatcacggcatcgccgcgaaccggaacgccagtaccgggagcaccgggctcgtgctc
ctgctcgtcgtgctgacctggctgctgagcctgcccgcggccacgcacgcgctcgcgaac
ggcctcgccggcaccccgccgatgggctggaacagctggaaccaggtccgctgctacgac
ctcaccgaggacgtcgtcaagcaggcggccgacgcgctcgccgacacgggcttgcgtgac
gcgggttaccactacgtcgtcgtcgacgactgctggcaggcccccacccgggcggcggac
ggctcgctgcagccggacccgaagcgcttcccgcacggcatcgccgacctcgccgactac
gtgcactcccgcggcctgctgttcggcatctacgccgtgcccggcagccggacctgcgcg
atggcgaacgacgcctacccggcggccggcatcggctcgctcggccacgagcgccaggac
gccgagacgttcgaccgctggggtgtcgactacctcaagtacgactggtgcaacgccgac
accgtcgacggcctcgaccggaaggccgcgttcgagaagatgcgcgacgaactggccgcg
ctgccccgcccgatcgtctacgcgatctccgagtacggcgtctccagcccgtggacctgg
gcgcggccggtggcgaacctctggcgcaccacttacgacctggtcccgacctgggactcg
gtgctcgcgacgatcgaccagcaggccggcgtcgccgcccacagcggctcgcccggcggc
tggaacgacccggacatgctccaggtcggcaacggcacgctgaccgccgacgaggcccgc
gcgcacttcagcgtctgggccgtgctgaacgcgccgctgttcgccggcaccgacccggcg
aagctgagcgacaccgacctcgcgacgctgggcaacgccgaggccatcgccgtcgaccag
gacttcgcgggcagccaggggcggcagctcgacgccggtcccggctaccaggtgtgggga
aaaccgctgagcggcggcggtttcgcggtggtactgctcaacaccggcagcaccaccgcg
accgtctccgcggcgatcccgggcgcgtggaacgtccgggatctgtgggcgcaccgggaa
acgggcactgtcgtcggcaccgtttcctcgaccctgcggccgcacgcggcggccttgctg
aagctcacaccgaggtga

DBGET integrated database retrieval system