KEGG   Amycolatopsis mediterranei S699: RAM_09695Help
Entry
RAM_09695         CDS       T01822                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RAM_09695
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RAM_09695
   00630 Glyoxylate and dicarboxylate metabolism
    RAM_09695
Enzymes [BR:amn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RAM_09695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2051312..2052889
Genome map
AA seq 525 aa AA seqDB search
MSSEVQVLGDPVERGDEILTPEALAFLAGLHDAFAGRRDELLQARGKRREEARTTGRLDF
LPETEEIREGDWQVAGAPPALRDRRVEITGPTDRKMTINALNSGAKVWLADLEDANTPHW
ANVVSGQVNLYDAVRETITLESGGKSYALKDDVEHATIVVRPRGWHLPESHLTFGGREGV
GALVDFGLHFFHNAAELLKRGKGPYYYLPKMESHLEARLWNDVFTHAEKTLGIEHGTVRA
TVLIETIPAAFEMEEILYELREHASGLNAGRWDYLFSVIKYFRDAGEKFVLPDRNSVTMT
APFMRAYTELLVRTCHKRGAFAIGGMAAFIPSKDPETNKGAFEKVHADKSREAGDGFDGS
WVAHPGMVELCKEEFDKVLGDKPNQLDRTRDEVSVTADQLLDVASTPGGATAAGLRAAVD
VGVRYIASWLGGNGAAAIHNLMEDAATAEISRSQIWQWVKNGTTLDSGDVVTAELVRGVL
ADVRGELAGELKPEQLEPAVELFEQVALAEEFPDFLTLPAYERIK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgaagtccaggtgctgggcgacccggtcgagcgcggcgacgagatcctcacg
ccggaggcgctcgccttcctcgccggcctccacgacgccttcgccggccgccgcgacgag
ctgctccaggcgcgcggcaagcgtcgcgaagaggcccggaccaccggccggctcgacttc
ctgcccgagaccgaggagatccgcgaaggcgactggcaggtcgccggcgcgccgcccgcg
ctgcgggaccgccgcgtcgagatcaccgggccgaccgaccgcaagatgaccatcaacgcg
ctcaactccggcgcgaaggtgtggctggccgacctcgaggacgccaacaccccgcactgg
gcgaacgtggtgtccggccaggtcaacctctacgacgccgtccgcgagacgatcaccctg
gagagcggcggcaagagctacgcgctgaaggacgacgtcgagcacgcgacgatcgtggtc
cgcccgcggggctggcacctgcccgagagccacctcaccttcggcggccgcgagggtgtc
ggcgcgctcgtcgacttcggcctgcacttcttccacaacgcggccgagctgctcaagcgc
ggcaagggcccgtactactacctgccgaagatggagagccacctcgaagcgcggctctgg
aacgacgtcttcacccacgccgagaagacactcggcatcgagcacggcaccgtccgcgcg
accgtgctgatcgagaccatcccggccgcgttcgagatggaagagatcctctacgagctg
cgcgagcacgcctcgggcctcaacgccggccgctgggactacctgttcagcgtgatcaag
tacttccgcgacgcgggcgagaagttcgtgctgccggaccgcaactcggtcaccatgacc
gcgccgttcatgcgcgcctacaccgagctgctggtgcgcacctgccacaagcgcggtgcc
ttcgcgatcggcggcatggccgcgttcatcccgagcaaggaccccgagaccaacaagggc
gccttcgagaaggtccacgcggacaagtcgcgcgaggccggcgacggcttcgacggttcc
tgggtcgcgcacccgggcatggtcgagctctgcaaggaggagttcgacaaggtcctcggc
gacaagcccaaccagctcgaccgcacccgcgacgaggtgagtgtcacggccgaccagctg
ctcgacgtcgcttcgacgccgggcggggcgacggcggccggcctgcgtgccgcggtcgac
gtcggcgtccgctacatcgcgtcctggctgggcggcaacggcgcggcggccatccacaac
ctgatggaggacgccgccaccgccgagatctcgcgctcgcagatctggcagtgggtcaag
aacgggaccactttggacagtggcgacgtcgtgacggcggagctggtgcgcggggtgctg
gccgacgtccgcggcgagctggccggcgagctcaagcccgagcagctggagcccgcggtg
gagctgttcgagcaggtcgcgctggccgaggagttcccggacttcctgacgctgcccgcc
tacgagcggatcaagtag

DBGET integrated database retrieval system