KEGG   Amycolatopsis mediterranei S699: RAM_09755Help
Entry
RAM_09755         CDS       T01822                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00052  Galactose metabolism
amn00561  Glycerolipid metabolism
amn00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RAM_09755
  Lipid metabolism
   00561 Glycerolipid metabolism
    RAM_09755
   00600 Sphingolipid metabolism
    RAM_09755
Enzymes [BR:amn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     RAM_09755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Ricin_B_lectin RicinB_lectin_2 Melibiase Melibiase_2_C
Motif
Other DBs
NCBI-ProteinID: AEK40441
UniProt: G0FXH5
Position
complement(2064466..2066043)
Genome map
AA seq 525 aa AA seqDB search
MRRVLLAAVTLAAAVSLTSPARALENGLARTPPMGWNTWNTFECNINETLVKQTTDLMVS
SGMRDRGYTYVNLDDCWMTRSRDSDGNLVADPAKFPSGLKALGDYIHTRGMKFGIYESAG
TMTCQSYPGSLGHEQADANRFASWGVDYLKYDNCFNNGSNSQEDYIRRYSAMRDALRATG
RPIAYSICEWGDFAPATWAADVGNLWRTTGDITNNWGTVDAIYRQNVGLASAAKPGAWND
PDMLEVGDGMDFQEDRAHFTLWAAMAAPLIAGADLRSASVATFSTYLNSDVIAVDQDSLG
KQARRIATGDGMDVLAKPLRGGDVAVVLFNENGSARTISTTAAAAGLPSASSYRLTNLWS
KELTTSTGGISANVPSHSTVIYRVKANSSGSSIGTAGPIQGASSSRCIDVSGGSATAGTA
VDIWDCGGGPIQAWTPTAAGELKAGGLCLDAGGGTSAAGTKLIVWTCHGGGNQKFKLEAD
GSITQAGLCVDVTGGDKPAGNANGTPLELWNCNDDANQNWSLRSR
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgagtcctcctcgccgccgtcaccctcgccgccgccgtctcgctcacgagcccg
gcccgcgccctcgaaaacggtctcgcccgcaccccgccgatgggctggaacacctggaac
accttcgagtgcaacatcaacgaaaccctcgtcaagcagaccaccgacctgatggtcagc
tccggcatgcgcgaccgcggctacacctacgtcaacctggacgactgctggatgacgagg
tcccgcgacagcgacggcaacctggtcgccgatcccgcgaagttccccagcggcctcaag
gcgctcggcgactacatccacacccgcggcatgaagttcggcatctacgaaagcgccggc
acgatgacgtgccagagctaccccggcagcctcggccacgaacaggccgacgccaaccgc
ttcgcgagctggggcgtcgactacctcaagtacgacaactgcttcaacaacggcagcaac
agccaggaggactacatccggcgctactcggcgatgcgcgacgcgctgagggccaccggg
cgcccgatcgcctacagcatctgcgaatggggtgacttcgccccggcgacctgggccgcg
gacgtcggcaacctgtggcgcaccaccggcgacatcaccaacaactggggcaccgtcgac
gcgatctaccgccagaacgtcgggctcgcctccgccgcgaagccgggcgcctggaacgac
ccggacatgctcgaagtcggcgacggcatggacttccaggaggaccgcgcgcacttcacg
ctctgggcggcgatggccgcgcccctgatcgcgggcgccgatctgcgctccgcgagcgtc
gccaccttctccacctacctcaactccgacgtcatcgccgtcgaccaggactcgctcggc
aagcaggcgcggcggatcgcgaccggcgacggcatggacgtcctcgcgaaaccgctccgc
ggcggcgacgtggccgtggtgctgttcaacgagaacggcagcgcacgcacaatttcgacg
acggccgccgcggccgggctgccctccgcgtcgagctaccggctgaccaacctgtggtcg
aaggagctgaccacgagcaccggcgggatcagcgcgaacgtcccgtcgcacagcacggtg
atctaccgcgtcaaggcgaactcctccgggagcagcatcggcaccgccgggccgatccag
ggggcgtcctcgtcccgctgcatcgacgtcagcggcggctcggcgaccgccggcaccgcg
gtcgacatctgggactgcggcggcggccccattcaggcctggacgcccaccgccgccggc
gagctcaaggccggggggctctgcctcgacgccggcggcggcacctccgcggccggcacg
aagctcatcgtctggacctgtcacggcggcgggaaccagaagttcaagctcgaggccgac
ggctcgatcacccaggccgggctgtgcgtcgacgtcaccggcggcgacaagcccgccggc
aacgccaacggcacgccgctcgaactgtggaactgcaacgacgacgccaaccagaactgg
agcctcaggtcccggtga

DBGET integrated database retrieval system