KEGG   Amycolatopsis mediterranei S699: RAM_10265Help
Entry
RAM_10265         CDS       T01822                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00260  Glycine, serine and threonine metabolism
amn00750  Vitamin B6 metabolism
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01120  Microbial metabolism in diverse environments
amn01230  Biosynthesis of amino acids
Module
amn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RAM_10265
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RAM_10265
Enzymes [BR:amn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RAM_10265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEK40543
UniProt: G0FZU4
Position
complement(2164002..2165213)
Genome map
AA seq 403 aa AA seqDB search
MPYSFLSHLECSRTGERLDADVVQGLSPAGAPLLARYDLDGVRETVTPKEIAGREPTLWR
YHEVLPVRSAEHVVSLGEGMTPLLRLPRYGRELGLSRLWMKDEGLIPTGTFKARGAAVGV
SRAAELGVRGIAMPTNGNAGAAWALYAARAGLSSLVAMPADAPAITMRECVAAGAELYRV
DGLIGDAGKLVAGAVSRRPGVRDVSTLKEPYRIEGKKTMGYEIAEQFGWRLPDVILYPTG
GGVGIIGIYKALLEMRELGWVSGPLPRLVAVQATGCAPIVSAFTRGERESTPFPDARTVA
FGITVPKALGDFLVLDAVYATGGTAIAVTDDELLAAQRELAAREGTFVCPEGGACFAALR
HLRESGWLEGDEDVVVLNTGAGIKYPETVPLDVPLPAKGDAIP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtactccttcctcagccacctcgagtgttcccggaccggcgaacgcctggacgcc
gacgtcgtccagggcctctccccggcgggcgcgccgctgctcgcgcgctacgacctcgac
ggcgtccgcgaaaccgtgacgccgaaggagatcgccgggcgcgagccgacgctgtggcgc
taccacgaggtgctgccggtgcgctcggccgagcacgtcgtcagcctcggcgaaggcatg
acgccgttgctgcggctgccgcgctacggccgcgagctggggctgtcgcgcctgtggatg
aaggacgaaggcctgatcccgaccggcacgttcaaggccaggggcgccgcggtcggcgtc
tcccgggcggccgaactgggcgtgcgcgggatcgcgatgccgacgaacggcaacgccggc
gcggcctgggcgttgtacgcggcgcgcgcggggctgtcgagcctggtcgcgatgccggcc
gacgccccggcgatcaccatgcgcgagtgcgtcgccgccggtgccgagctgtaccgggtg
gacggtctcatcggcgacgcgggcaagctcgtcgccggggcggtttcgcggcgtcccgga
gtgcgggacgtttcgacgctgaaagagccgtaccgcatcgagggcaagaagacgatgggg
tacgagatcgccgagcagttcggctggcggctgcccgacgtcatcctctaccccaccggc
ggcggcgtcggcatcatcgggatctacaaggccctgctggagatgcgggagctgggctgg
gtttccggtccgctgccccggctcgtcgctgtccaggccaccgggtgcgcaccgatcgtc
tcggcgtttacgcgcggcgagcgggaaagcacgccgttcccggacgcccggacggtcgcc
ttcggcatcaccgtgcccaaggcgctgggcgacttcctcgtgctcgacgccgtgtacgcg
accggcggcaccgcgatcgccgtcaccgacgacgaactgcttgcggcccaacgggaactg
gccgcacgggaaggcactttcgtctgcccggagggcggcgcgtgcttcgccgcgctgcgg
caccttcgcgagtccgggtggctcgagggcgacgaagacgtcgtcgtgctcaacaccggc
gccgggatcaagtacccggagacggtgccgctggacgtcccactgccggccaagggtgac
gcgattccttaa

DBGET integrated database retrieval system