KEGG   Amycolatopsis mediterranei S699: RAM_10335Help
Entry
RAM_10335         CDS       T01822                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00900  Terpenoid backbone biosynthesis
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01130  Biosynthesis of antibiotics
Module
amn_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RAM_10335
Enzymes [BR:amn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     RAM_10335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: AEK40557
UniProt: G0FZV8
Position
2179405..2180583
Genome map
AA seq 392 aa AA seqDB search
MLGSTGSIGVQALDVAARNPHLFRVAGIAAGGADPAALAAQAIAHGVEAVAVTRATAAED
VQLALYAEAQQRGYARGEFKLPRLFAGSDAVTELIDAVKVDTVLNALPGSRGLEPTLKAL
ATGATLALANKESLIAGGPLVLAAAKPGQLVPVDSEHSAIAQALRAGHRSEVARLVLTAS
GGPFRGRKRAELAGVTVEQAMAHPTWSMGPLITINSATLVNKGLELIEAALLFDVEPAKI
DVTVHPQSIVHSMVTFADGSTIAQASPPDMRLPIALALHWPDRVPDAAPACTWDQAATWT
FEPLDDEAFPAVELARHCGTAGGCLPAVYNAANEELVSAFLAQNTSFTSIVDTVSEVVGA
ADEWRREPRDVEDVLAAERWARARAGSIIEGK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggctcgaccgggtccatcggcgtgcaggccctcgacgtcgccgcgcgcaacccg
cacctgttccgggtggccgggatcgccgcgggcggcgccgatccggccgcgctcgccgcg
caggcgatcgcccacggcgtcgaggccgtcgccgtgacgagggccacggccgccgaagac
gtccagctcgcgctgtacgccgaagcgcagcagcgcgggtacgcccggggcgagttcaag
ctcccgcggctcttcgcgggctccgacgccgtcaccgagctgatcgacgcggtcaaggtc
gacaccgtgctcaacgcgctcccgggctcccgcggcctcgagccgaccctcaaagcgctc
gccaccggcgccaccctcgcgctggccaacaaggagtccctgatcgccggcgggccgctg
gtgctcgccgcggccaagcccgggcagctcgtgcccgtcgactccgagcactccgccatc
gcccaggccctgcgcgccgggcaccgcagcgaggtcgcccggctcgtcctcaccgcctcc
ggcggcccgttccgcggccgcaagcgcgcggagctggccggcgtcaccgtcgagcaggcg
atggcgcacccgacctggtcgatgggcccgctcatcacgatcaactccgccaccctggtc
aacaagggcctggagctgatcgaggcggcgctgctgttcgacgtcgagcccgcgaagatc
gacgtcaccgtgcacccgcagtcgatcgtgcactcgatggtgaccttcgccgacggctcg
acgatcgcccaggccagcccgcccgacatgcggctgcccatcgcgcttgcgctgcactgg
cccgaccgggtccccgacgccgcccccgcgtgcacctgggaccaggccgcgacctggacg
ttcgagccgctggacgacgaggccttcccggccgtcgagctggcccggcactgcggcacc
gcgggcggctgcctgcccgccgtctacaacgccgcgaacgaggagctcgtgtccgctttc
ctggcgcagaacaccagcttcacgtcgatagtggacactgtttccgaggtggtgggagcc
gccgacgaatggcgtcgcgaaccacgcgacgtcgaggacgttctcgcggccgagcggtgg
gctcgtgcgcgggccggttcgatcatcgaggggaagtag

DBGET integrated database retrieval system