KEGG   Amycolatopsis mediterranei S699: RAM_11680Help
Entry
RAM_11680         CDS       T01822                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amn01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:amn00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:amn00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2440165..2441376
Genome map
AA seq 403 aa AA seqDB search
MTQEHDKHDPDERGYYGPYGGRFMPEALIGVVDEVATEYDKARHDPEFLNEFNRLLRDYA
GRPSLLTEAKRFGEHAGGARVFLKREDLNHTGSHKINNVLGQALLTKRMGKKRVIAETGA
GQHGVATATACALLDLDCVVYMGEVDTERQALNVARMRLLGAEVIPVKTGSRTLKDAINE
ALRDWVTNADTTHYLFGTAAGPAPFPTMVRNFHHVIGTEAREQILEQAGRLPDVVAACVG
GGSNAIGIFSGFYDDPSVRLVGLEPGGEGIEGNRHGATLTKGTPGNLHGAMTYLLQDDDG
QTVESHSISAGLDYPGVGPEHAWLKDTGRAEYRPITDAQAMDAFKLLSRTEGIIPAIESA
HALAGALDLGRELGPEGLIVVNLSGRGDKDMDTAAKWFGLVNG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaggagcacgacaagcacgacccggacgagcgcggctactacggcccgtacggg
ggccggttcatgccggaggcgctgatcggcgtcgtcgacgaggtcgccaccgagtacgac
aaggcccggcacgacccggagttcttgaacgagttcaaccgcttgcttcgcgattacgcg
ggccgcccgtcgctgctcaccgaggccaagcgcttcggcgagcacgccggcggcgcgcgg
gtgttcctcaagcgcgaggacctgaaccacaccggctctcacaagatcaacaacgtgctg
ggtcaggcgctgctcaccaagcggatgggcaagaagcgcgtcatcgccgagaccggcgcg
ggccagcacggcgtcgcgacggccaccgcgtgcgcgctgctcgaccttgattgcgtcgtc
tacatgggcgaggtcgacaccgagcgccaggcgctgaacgtggcccgcatgcggctgctc
ggcgccgaggtgatcccggtcaagaccgggtcgcggacgctgaaggacgcgatcaacgag
gcgctgcgcgactgggtcaccaacgccgacaccacgcactacctcttcggcacggccgcc
gggccggcgccgttcccgacgatggtgcgcaacttccaccacgtcatcggcaccgaggcc
cgcgagcagatcctcgagcaggccgggcgcctgcccgacgtcgtcgcggcctgcgtcggc
ggcgggtcgaacgcgatcggcatcttctccggcttctacgacgacccgtccgtgcggctg
gtcggcctggagccgggcggcgagggcatcgagggcaaccgccacggcgccaccctgacc
aagggcaccccgggcaacctgcacggcgcgatgacgtacctgctgcaggacgacgacggc
cagacggtcgagtcgcactcgatctcggccgggctcgactacccgggcgtcggcccggag
cacgcgtggctcaaggacaccggccgcgccgagtaccgcccgatcaccgacgcccaggcg
atggacgcgttcaagctgctgtcccgcaccgaaggcatcatcccggcgatcgagtcggcg
cacgcgctggccggcgcgctggacctgggccgcgaactgggtcctgaaggattgatcgtg
gtgaatttgtctggccgcggcgacaaggacatggacacggcggccaagtggttcggactg
gtgaacggatga

DBGET integrated database retrieval system