KEGG   Amycolatopsis mediterranei S699: RAM_11685Help
Entry
RAM_11685         CDS       T01822                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RAM_11685
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RAM_11685
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RAM_11685
Enzymes [BR:amn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RAM_11685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2441373..2442164
Genome map
AA seq 263 aa AA seqDB search
MSGLDDLFAATRAEGRAALIGYLPAGFPTVEGSKDLIAACVDGGADLIEVGVPYSDPVMD
GPTIQAASVTALDNGFRLKHVFEVVESISARGGRAVVMTYWNPVNRYGVDRFARDLASAG
GLGLITPDLIPDEAGAWIAASETHGLDRTFLVAPSSSEERLALTAAASSGFIYATAVMGV
TGARDQVGAGAEELVRRTRVHTSLPIGVGLGVRSGDQAAEVASFADAVIVGSALVTAAAE
GSSGVRALSAELAEGVRRAVATA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggctcgacgacctcttcgccgcgacgcgcgccgaggggcgcgccgcgctgatc
ggctacctcccggcgggcttccccacggtcgagggctcgaaggacctgatcgcggcctgc
gtcgacggcggcgcggacctgatcgaggtcggcgtcccgtattcggacccggtgatggac
ggcccgaccatccaggccgcctcggtgaccgcgctggacaacgggttccgcctcaagcac
gtgttcgaggtcgtcgagtcgatctcggcccgcggcggccgtgcggtcgtgatgacgtac
tggaacccggtgaaccgctacggcgtggaccgcttcgcgcgtgacctcgcctcggcgggc
gggctcggcctgatcacgccggacctgatcccggacgaggccggcgcgtggatcgcggca
tcggagacccacggcctggaccgcaccttcctggtggcgccttcgtcgtcggaagagcgg
ctcgcgttgacggcggcggcgtcgtcgggcttcatctacgcgaccgcggtgatgggcgtg
acgggcgcgcgcgaccaggtcggagccggagcggaggagctggtgcgccgcacgcgagtg
cacacttcgcttccgatcggcgtgggcctgggtgtccggtcgggcgaccaggcggccgag
gtggcgtccttcgcggacgcggtgatcgtgggctcggccctggtcacggcggcggccgaa
ggctcgtcgggcgttcgtgccctgtcggccgagctggccgagggcgtgcgccgggcggtc
gccaccgcttga

DBGET integrated database retrieval system