KEGG   Amycolatopsis mediterranei S699: RAM_13165Help
Entry
RAM_13165         CDS       T01822                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2762823..2764778
Genome map
AA seq 651 aa AA seqDB search
MPEEIPARSALHELADLHGVATRYQNADRVWVDVDDDVVVAVLGQFGVDATGDQAIAAAL
SAAREAPAALPPTIVVREGTGKALGVDAEVVLEDGTRRRADGHLPADLPLGWHRVVTADQ
DVVLAVVPAKLPRVPPAWGWMLQLYALHSAGSWGIGDYADLATFAARSAAELDAGVLLVN
PVQAISPAHPIERSPYSPASRRFANPVYLRVTATETFEQADEATRAAVESLAPEREGELI
DYDAVWTAKRAALELLWPHRVEEVPEDGDLRAFALFCALAEQHGADWRDWPEDLHDPAGA
ATAKAREELEDRVAFHAWLQHLCRVQLEAARTAARGAGMTAGIVHDLPVGVHPGGADTWA
VRDVFAADVRVGAPPDAFNQQGQDWNLPPWRPDKLAEAGYAPFRDVIRGVLRFADGIRVD
HIAGLWRLWWIPPGEPAHRGTYVHYDAEAMVGVLALEAHRAGAIVVGEDLGTVEEVVTDT
MHERGMLSSAVLWFERDWDAPGQPFTPPESWDPDAMASISTHDLPTVSGWLKSEHVRVRA
ELGLLDRGVEAEEEAAAGERKALLELVAREGIPGDDPVVALHTLLAKAASRLVLTSPADV
AGQVRQPNLPGTVDQYPNWRIRLPVSVDGFFTAQGVRAAVAPLAAARPLPR
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaagagatccccgcccgcagcgccctgcacgagctcgccgacctccacggggtc
gccacccggtaccagaacgccgatcgggtctgggtcgacgtggacgacgacgtcgtcgtc
gccgtcctcggccagttcggcgtcgatgcgaccggcgaccaggccatcgccgccgctctg
agcgccgcgcgggaggcgccggccgcgctgccgccgaccatcgtcgtgcgggagggcacc
ggcaaggcgctgggcgtcgacgccgaagtcgtcctcgaggacgggacgcggcggcgcgcc
gacggtcacctgcccgcggacctgccgctcggctggcaccgggtcgtcaccgccgaccag
gacgtcgtgctggccgtggtgccggcgaagctgccgcgagtcccgcccgcctgggggtgg
atgctgcagctctacgccctgcactcggccgggtcctggggcatcggcgactacgccgac
ctcgccaccttcgccgcccggtcggccgcggaactggatgccggcgtcctgctggtgaac
ccggtgcaggcgatcagccccgcgcacccgatcgaacgatcgccgtactcgccggcaagc
cggcggttcgccaacccggtctacctgcgcgtcacggccaccgagacgttcgaacaggcc
gacgaggcgacccgggcggccgtcgagtccctggccccggagcgcgaaggcgagctgatc
gactacgacgccgtctggaccgccaagcgggccgcgctcgagctgctgtggccgcaccgc
gtcgaagaggtgcccgaagacggcgacctgcgcgctttcgccctcttctgcgccctggcc
gagcagcacggcgccgactggcgggactggccggaggacctgcacgacccggccggagcg
gccaccgcaaaggcgcgcgaagagctcgaagaccgcgtcgccttccacgcgtggctccag
cacctctgccgggttcagctggaagcggcgcggacggctgcgcgcggggccgggatgacc
gccgggatcgtgcacgacctgccggtgggggtgcaccccggcggggccgacacgtgggcc
gtgcgggacgtcttcgccgccgacgtgcgggtcggcgccccacccgacgccttcaaccag
cagggccaggactggaacctgccgccgtggcggccggacaagctggccgaggccgggtac
gcgccgttccgggacgtcatccggggcgtcctgcgcttcgccgacggcatccgcgtcgac
cacatcgccggcctgtggcggctctggtggatcccgccgggcgagcccgcgcaccgcggc
acgtacgtccattacgacgccgaagcgatggtcggcgtgctcgcgctcgaagcgcaccgc
gccggggccatcgtggtgggggaggacctcgggaccgtcgaggaggtcgtcaccgacacc
atgcacgaacgggggatgctcagctcggccgtgctgtggttcgagcgcgactgggacgcg
cccggccagccgttcacaccgccggagagctgggacccggacgccatggccagcatctcc
acgcacgacctgccgacggtgtcgggctggctgaagagcgagcacgtccgggtccgggcc
gagctgggactgctggaccgcggggtcgaagccgaggaagaagcggccgccggcgagcgc
aaggcgctgctggaactcgttgcccgggaagggatccccggcgacgacccggtcgtcgcg
ctgcacaccctgctcgcgaaggccgcttcgcggctcgtgctgacctcgccggccgacgtc
gcgggccaggtgcggcagccgaatctgcccggaaccgtcgaccagtaccctaactggcgg
attcgcctgcccgtcagcgtggacggcttcttcaccgcgcagggggtccgcgcagcggtc
gcaccgctggcggcggcccggccgctgccccggtaa

DBGET integrated database retrieval system