KEGG   Amycolatopsis mediterranei S699: RAM_13220Help
Entry
RAM_13220         CDS       T01822                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00010  Glycolysis / Gluconeogenesis
amn00520  Amino sugar and nucleotide sugar metabolism
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01120  Microbial metabolism in diverse environments
amn01130  Biosynthesis of antibiotics
amn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RAM_13220
   00520 Amino sugar and nucleotide sugar metabolism
    RAM_13220
Enzymes [BR:amn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     RAM_13220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AEK41134
UniProt: G0G8Z3
Position
complement(2783184..2783951)
Genome map
AA seq 255 aa AA seqDB search
MVEATRRGFGIDIGGSGIKGALVDLDSGQLIGDRIRIETPKPSTPSAVADVVHDVVTQAG
WDGPVGVTLPAVVKKGVAHTAANIDKQWIGTDADALFAKRLGRSVDQVAMLNDADAAGMA
EIRFGDPVARTGVTALLTFGTGIGSAVFQDGKLVPNTEFGHLEIDGHDAEKRAAASVKDN
EGLSYPEWAKRVHRYLTVLENLIWPDLFIVGGGVSKKAEKWVPLLDIRTPVLVASLQNNA
GIVGAAAAAAEGIQH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtggtggaggcgacccgccgaggtttcggcatcgacatcggcggcagcgggatcaagggc
gccttggtcgacctggactccggccagctcatcggcgaccgcatccggatcgagacgccg
aaaccgtccacgccgtcggcggtggcggacgtcgtgcacgacgtcgtcacgcaggcgggc
tgggacggcccggtcggcgtgaccctgccggcggtcgtcaagaagggcgtcgcgcacacc
gcggccaacatcgacaagcagtggatcggcaccgacgccgacgcgctgttcgccaagcgg
ctcggccggagcgtcgaccaggtcgcgatgctgaacgacgccgacgcggcgggcatggcg
gagatccgcttcggcgacccggtcgcgcgcacgggcgtgacggcgctgctcaccttcggc
accggcatcggcagcgcggtgttccaggacggcaagctcgtccccaacaccgaattcggc
cacctcgagatcgacggccacgacgccgagaagcgcgcggccgcttcggtgaaggacaac
gaggggctctcctaccccgaatgggccaagcgcgtgcaccgttacctgaccgtgctggag
aacctgatctggcccgacctgttcatcgtcggcggcggcgtcagcaagaaggccgagaaa
tgggtgccgctgctggacatccgcactccggtgctggtggcgagcctgcagaacaacgcc
gggatcgtcggcgccgcggccgccgcggcggagggcatccagcactga

DBGET integrated database retrieval system