KEGG   Amycolatopsis mediterranei S699: RAM_13220Help
Entry
RAM_13220         CDS       T01822                                 

Definition
polyphosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:amn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:amn00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:amn00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2783184..2783951)
Genome map
AA seq 255 aa AA seqDB search
MVEATRRGFGIDIGGSGIKGALVDLDSGQLIGDRIRIETPKPSTPSAVADVVHDVVTQAG
WDGPVGVTLPAVVKKGVAHTAANIDKQWIGTDADALFAKRLGRSVDQVAMLNDADAAGMA
EIRFGDPVARTGVTALLTFGTGIGSAVFQDGKLVPNTEFGHLEIDGHDAEKRAAASVKDN
EGLSYPEWAKRVHRYLTVLENLIWPDLFIVGGGVSKKAEKWVPLLDIRTPVLVASLQNNA
GIVGAAAAAAEGIQH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtggtggaggcgacccgccgaggtttcggcatcgacatcggcggcagcgggatcaagggc
gccttggtcgacctggactccggccagctcatcggcgaccgcatccggatcgagacgccg
aaaccgtccacgccgtcggcggtggcggacgtcgtgcacgacgtcgtcacgcaggcgggc
tgggacggcccggtcggcgtgaccctgccggcggtcgtcaagaagggcgtcgcgcacacc
gcggccaacatcgacaagcagtggatcggcaccgacgccgacgcgctgttcgccaagcgg
ctcggccggagcgtcgaccaggtcgcgatgctgaacgacgccgacgcggcgggcatggcg
gagatccgcttcggcgacccggtcgcgcgcacgggcgtgacggcgctgctcaccttcggc
accggcatcggcagcgcggtgttccaggacggcaagctcgtccccaacaccgaattcggc
cacctcgagatcgacggccacgacgccgagaagcgcgcggccgcttcggtgaaggacaac
gaggggctctcctaccccgaatgggccaagcgcgtgcaccgttacctgaccgtgctggag
aacctgatctggcccgacctgttcatcgtcggcggcggcgtcagcaagaaggccgagaaa
tgggtgccgctgctggacatccgcactccggtgctggtggcgagcctgcagaacaacgcc
gggatcgtcggcgccgcggccgccgcggcggagggcatccagcactga

DBGET integrated database retrieval system