KEGG   Amycolatopsis mediterranei S699: RAM_13325Help
Entry
RAM_13325         CDS       T01822                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00330  Arginine and proline metabolism
amn01100  Metabolic pathways
Module
amn_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RAM_13325
Enzymes [BR:amn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RAM_13325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489 Gp5_C
Motif
Other DBs
NCBI-ProteinID: AEK41155
UniProt: G0G914
Position
complement(2804603..2805547)
Genome map
AA seq 314 aa AA seqDB search
MPNTGPLDSSRIPRFAGFATFARLPRIDQVERADVAVVGVPFDSGVSYRPGARFGPAAVR
EASRLLRPYHPELDVSPFAEKQVVDAGDIAVNPFNIGEAIETLQQEAEALQADGTRLVTV
GGDHTIALPLLRAAAKKHGPVALLHFDAHLDTWDTYFGEPYTHGTPFRRASEEGILDTSA
LSHVGTRGPLYGKRDLEEDRRLGFGIVTSGDVLRRGVAETVDALRQRIGDRPLYVSVDID
VLDPAHAPGTGTPEAGGMTSRELLEILRGLRDLNLVGADVVELAPAYDHAEITAIAASHI
AYDLVSLLTLGKGE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgcctaacaccggccccctcgactcgtcgcgcatcccccggttcgccggcttcgcgacc
ttcgcgcggctgccgcggatcgaccaggtcgagcgcgccgacgtcgccgtcgtcggggtg
cccttcgactccggcgtgtcctaccggcccggcgcgcggttcggcccggcggccgtccgc
gaggcgagccggctgctgcggccgtaccacccggagctggacgtctcgccgttcgccgaa
aagcaggtcgtcgacgcaggcgacatcgcggtcaacccgttcaacatcggcgaagcgatc
gagacgctgcagcaggaagccgaggcgctacaggcggacgggacgcggctggtgaccgtc
ggcggcgaccacaccatcgcgctgccgctgctgcgcgccgcggccaagaagcacggaccc
gttgccctgctgcacttcgacgcccacctggacacgtgggacacctacttcggcgagccg
tacacgcacggcacgccgttccggcgggcgtcggaggaaggcatcctcgacacgagcgcg
ctgtcgcacgtcggcacgcgcgggccgctgtacggcaagcgggacctcgaagaggaccgc
cggctcggcttcggcatcgtcacctccggcgacgtcctgcgccgcggcgtcgccgagacc
gtcgacgcgctgcggcagcgcatcggcgaccggccgctgtacgtctcggtcgacatcgac
gtgctcgacccggcccacgcccccggcaccgggacgcccgaggcgggcgggatgaccagc
cgcgagctgctggagatcctgcgcgggctgcgcgacctcaacctggtcggcgcggacgtc
gtcgagctggccccggcctacgaccacgccgagatcaccgccatcgcggcctcccacatc
gcctacgacctggtgagcctgctgaccttggggaagggcgaatga

DBGET integrated database retrieval system