KEGG   Amycolatopsis mediterranei S699: RAM_13440Help
Entry
RAM_13440         CDS       T01822                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:amn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2832101..2833501
Genome map
AA seq 466 aa AA seqDB search
MKRVAVVGGGVSGLTAAYRLRQLLGPEAEITVYEKTTAPGGKLRTAELAGVPYDVGAEAF
LVRRPEMLALARELGLDVVHPTKARAKIHAGGAVTGLPPGTVMGVPASAESVAGVLSETG
RQAVEAEPLLPELRLPGGDVPLGPLLRERFGDELVDRLVDPLLGGVYAGGADGLGLRATM
PGLASALAAGAGSLTAAAAAQLPANPSTAPVFGTVPGGLGTVIDRLTTASGAQLRTGLPV
CEIERHGDGWRLCIGAAPTAHAPADNLAEADAVVLAVPAPSARRLLTDLVPAASAAFGEV
ELASMAVVALALPPGTALPEASGILIGQGERDASGVPYASKAFTFSSRKWAHYGTGPVLV
RGSVGRFGEPGALQFDDVELVRVVRDDLARLTGVTAAPVETLVTRWGGGLPQYGTGHLER
VERIEKAVAEVPGLAIAGATLHGVGLPACVATAEAAAQRIAAHLTA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgcgtcgcggtcgtcgggggcggcgtttccgggctgaccgcggcgtaccggctc
cggcagctgctcggccccgaagccgagatcacggtgtacgagaagacgacggcgccgggc
gggaagctgcgcaccgccgaactcgccggggtgccctacgacgtcggcgccgaggcgttc
ctcgtccgccgtcccgaaatgctcgcgctggcccgcgagctcgggctcgacgtcgtccac
ccgacgaaggcgcgggcgaagatccacgcgggcggcgccgtcaccgggctgccgcccggc
acggtcatgggcgtgccggcgtcggcggagtcggtggccggggtgctttccgaaaccggc
cggcaggcggtcgaggccgagccgttgctgccggagctgcggctgccgggcggggacgtg
ccgctggggccgctgctgcgcgagcggttcggcgacgaactggtggaccggctggtcgac
ccgctgctcggcggcgtctacgcgggcggggcggacggcctcggcctgcgcgcgaccatg
cccggcctcgcctccgcgctggcggcgggcgcgggctcgctgaccgcggcggccgccgcc
cagctgccggcgaacccgtcgacggcgccggtgttcggcaccgtccctggcggcctcggc
acggtgatcgaccggctcaccacggcgtcgggcgcgcagctgcggaccggcctgccggtg
tgcgagatcgaacggcacggcgacggctggcggctgtgcatcggcgcggcaccgaccgcg
cacgcgccggcggacaacctcgccgaagcggacgcggtcgtgctcgcggtgcccgcgccg
tcggcccgccgcctgctcaccgacctcgtcccggcggcttcggcggccttcggcgaggtc
gaactggcgtcgatggcggtggtcgcgctggcactgccgcccggcaccgcgctgcccgag
gcgtcggggatcctgatcggccagggcgagcgggacgcttcgggcgtgccgtacgcgtcg
aaggcgttcacgttctcgtcgcggaagtgggcccactacggcaccggcccggtcctggtc
cgcggctcggtcggccggttcggcgagccgggcgcgctgcagttcgacgacgtcgagctg
gtccgcgtggtccgcgacgacctcgcccggctgacgggggtgacggcggcgccggtcgag
acgctggtgacgcggtggggcggcgggctgccgcagtacggcaccgggcacctcgagcgg
gtcgagcggatcgagaaggccgtcgcggaggtgccgggcctggcgatcgccggggcgacc
ctgcacggggtcgggctgccggcctgtgtcgcgacggcggaagccgcggcccagcggatc
gcggcgcacctgacggcgtga

DBGET integrated database retrieval system