KEGG   Amycolatopsis mediterranei S699: RAM_13960Help
Entry
RAM_13960         CDS       T01822                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RAM_13960
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RAM_13960
Enzymes [BR:amn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     RAM_13960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2929495..2930442
Genome map
AA seq 315 aa AA seqDB search
MKHLLATDGLDPALATAVLDTADELKHTLLGREVKKLPTLRGRTVITLFYENSTRTRVSF
EIAGKWMSADVINVSASSSSVNKGESLRDTALTLAAAGADCVIVRHPASGAAQRLSEWLA
GPGTSVVNAGDGTHEHPTQALLDAATLRERLGSLKDRRIAIVGDVLHSRVARSNIHLLSA
LGAEVVLVAPPTLLPYGVESLPVTVSHDLDAELPAVDAVMMLRVQAERMAGGGPGQSFFP
SAREYSIAYGLSEKRQKLLPDHAVVLHPGPMLRGMEIASAVADSPASAITEQVRNGVHVR
MAVLYHLLASEGAAA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcacctgctcgccaccgacggcctggacccggcgctggccacggccgtgctcgac
accgccgacgagctgaagcacacgctgctcggccgcgaggtcaagaagctgccgacgctg
cgcggccgcacggtgatcaccctgttctacgagaactcgacccgcacccgggtgtcgttc
gagatcgccggcaagtggatgagcgcggacgtgatcaacgtttccgcgtccagctcctcg
gtcaacaagggggagtcccttcgcgacaccgcgctgacgctggccgcggcgggtgccgac
tgcgtgatcgtccggcacccggccagcggagccgcccagcggctttcggagtggctggcc
gggcccggcacgtcggtggtcaacgccggcgacggcacccacgagcacccgacgcaggcg
ctgctcgacgcggccacgctgcgggagcgcctcggctccctcaaagaccgccggatcgcg
atcgtcggggacgtcctgcacagccgcgtcgcccgctcgaacatccacctgctctcggcc
ctgggcgccgaagtcgtgctcgtcgcgccgccgacgttgctgccttacggcgtcgaaagc
cttccggtgaccgtttcgcacgacctggacgccgagctgcccgcggtcgacgcggtgatg
atgcttcgcgttcaggcggaacggatggctggcgggggcccagggcagagctttttcccg
agcgcccgcgagtactcgatcgcctacggcctctcggaaaagcggcagaagctgctgccg
gaccacgcggtcgtcctgcaccccggtccgatgctgcgcgggatggagatcgcgagcgcg
gtcgccgactccccggcctcggccatcaccgaacaggtccgcaacggcgtccacgtgcgc
atggcggtcctctaccacctcctggccagcgaaggagccgccgcgtga

DBGET integrated database retrieval system