KEGG   Amycolatopsis mediterranei S699: RAM_14005Help
Entry
RAM_14005         CDS       T01822                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00230  Purine metabolism
amn01100  Metabolic pathways
Module
amn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RAM_14005
Enzymes [BR:amn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RAM_14005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 RsgA_GTPase AAA_33 AAA_22 AAA_29 MMR_HSR1 Rad17
Motif
Other DBs
NCBI-ProteinID: AEK41289
UniProt: G0G9M8
Position
2939680..2940336
Genome map
AA seq 218 aa AA seqDB search
MNGAGRDYPVSRGADRGSEPVAGEFSRHRLTVVSGPSGVGKSSVVGELRKLEPDVWFSVS
VTTRHPRPGEVDGAHYHFVDRAEFDAMVADGRLLEWAEFAGNRYGTPREPVEKALAEGRP
AVLEIELQGARQVRAAMPEARLVMLMPPSWEELVGRLTGRGTENEAAVQARLAEAERELA
AAGEFDHRLVNADVREAAEHLLNLITADQFSDEAEHHE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgaacggcgccggtcgtgactacccggtgagccggggcgccgaccgaggcagtgagccg
gtggcgggggagttctcccgccaccggctcaccgtcgtatcggggccttcgggagtcggg
aagtcgagcgtggtgggcgagctgcggaagctggagcccgacgtctggttcagcgtctcg
gtcaccacccgccacccgcgtcccggcgaagtcgacggggcgcactaccacttcgtcgac
cgcgcggagttcgacgcgatggtcgccgacggacggctgctggaatgggccgagttcgcc
ggcaaccgctacggcaccccgcgcgagccggtcgagaaggcgctcgccgagggccgcccg
gccgtcctggagatcgaactgcagggcgcccgccaggtccgcgcggcgatgccggaggcc
cggctggtgatgctgatgccgccgtcgtgggaggaactggtcggcaggctcaccgggcgc
ggcaccgaaaacgaggccgccgtgcaggcccggctggccgaagcggagcgcgagctggcg
gcggcgggggagttcgaccaccgcctcgtcaacgccgacgtgcgggaggccgccgagcac
ttgctaaacttgattacagctgatcagttttccgacgaagcggagcaccacgagtga

DBGET integrated database retrieval system