KEGG   Amycolatopsis mediterranei S699: RAM_14005Help
Entry
RAM_14005         CDS       T01822                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RAM_14005
Enzymes [BR:amn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RAM_14005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2939680..2940336
Genome map
AA seq 218 aa AA seqDB search
MNGAGRDYPVSRGADRGSEPVAGEFSRHRLTVVSGPSGVGKSSVVGELRKLEPDVWFSVS
VTTRHPRPGEVDGAHYHFVDRAEFDAMVADGRLLEWAEFAGNRYGTPREPVEKALAEGRP
AVLEIELQGARQVRAAMPEARLVMLMPPSWEELVGRLTGRGTENEAAVQARLAEAERELA
AAGEFDHRLVNADVREAAEHLLNLITADQFSDEAEHHE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgaacggcgccggtcgtgactacccggtgagccggggcgccgaccgaggcagtgagccg
gtggcgggggagttctcccgccaccggctcaccgtcgtatcggggccttcgggagtcggg
aagtcgagcgtggtgggcgagctgcggaagctggagcccgacgtctggttcagcgtctcg
gtcaccacccgccacccgcgtcccggcgaagtcgacggggcgcactaccacttcgtcgac
cgcgcggagttcgacgcgatggtcgccgacggacggctgctggaatgggccgagttcgcc
ggcaaccgctacggcaccccgcgcgagccggtcgagaaggcgctcgccgagggccgcccg
gccgtcctggagatcgaactgcagggcgcccgccaggtccgcgcggcgatgccggaggcc
cggctggtgatgctgatgccgccgtcgtgggaggaactggtcggcaggctcaccgggcgc
ggcaccgaaaacgaggccgccgtgcaggcccggctggccgaagcggagcgcgagctggcg
gcggcgggggagttcgaccaccgcctcgtcaacgccgacgtgcgggaggccgccgagcac
ttgctaaacttgattacagctgatcagttttccgacgaagcggagcaccacgagtga

DBGET integrated database retrieval system