KEGG   Amycolatopsis mediterranei S699: RAM_14230Help
Entry
RAM_14230         CDS       T01822                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00010  Glycolysis / Gluconeogenesis
amn00051  Fructose and mannose metabolism
amn00562  Inositol phosphate metabolism
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01120  Microbial metabolism in diverse environments
amn01130  Biosynthesis of antibiotics
amn01200  Carbon metabolism
amn01230  Biosynthesis of amino acids
Module
amn_M00002  Glycolysis, core module involving three-carbon compounds
amn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RAM_14230 (tpiA)
   00051 Fructose and mannose metabolism
    RAM_14230 (tpiA)
   00562 Inositol phosphate metabolism
    RAM_14230 (tpiA)
Enzymes [BR:amn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RAM_14230 (tpiA)
Exosome [BR:amn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RAM_14230 (tpiA)
  Exosomal proteins of bladder cancer cells
   RAM_14230 (tpiA)
  Exosomal proteins of melanoma cells
   RAM_14230 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEK41334
UniProt: G0FHV7
Position
2991536..2992321
Genome map
AA seq 261 aa AA seqDB search
MARKPFIAGNWKMNQNHLEAIALVQKIAFALPEKYYAKVDVAVLPPFTDIRSVQTLVDGD
KLSLTYGAQDVAPQDSGAYTGDISGLMLAKLGCKFVTVGHSERREYHAESDELVNKKVKA
ALKHGITPILCIGEKLEVREAGEHIHHTTTQLIEGLKGLKAEQVKDVVIAYEPVWAIGTG
KVASSADAEEVCKAIRATLQEKYGDEVASSVRVLYGGSVKSGNISELVGCENIDGALVGG
ASLDGEEFTKLCALAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgcaagccgttcatcgccggcaactggaagatgaaccagaaccacctcgaggcg
atcgcgctggtgcagaagatcgccttcgcgctgccggagaagtactacgcgaaggtcgac
gtggcggtgctgccgccgttcaccgacatccgcagcgtgcagaccctggtcgacggcgac
aagctgtcgctcacctacggcgcgcaggacgtcgcgccgcaggattccggcgcctacacc
ggtgacatttcgggcctgatgctggccaagctgggctgcaagttcgtcacggtcgggcac
tcggagcggcgcgaataccacgccgagtccgacgagctggtcaacaagaaggtcaaggcc
gcgctcaagcacggcatcacgccgatcctctgcatcggggagaagctcgaggtccgcgag
gccggcgagcacatccaccacaccacgacgcagctgatcgagggcctgaagggcctcaag
gccgagcaggtcaaagacgtggtgatcgcgtacgagccggtctgggcgatcggcaccggc
aaggtcgcctcgtccgcggacgccgaagaggtctgcaaggccatccgggcgaccctccag
gagaagtacggcgacgaggtggcttcgtccgtccgggtgctctacgggggatcggtgaag
tcgggcaacatcagcgagctggtgggctgcgagaacatcgacggtgccctggtcggcgga
gcgagcctcgacggcgaggagttcacgaaactctgcgcactcgctgcaggcgggccgctg
ccctga

DBGET integrated database retrieval system