KEGG   Amycolatopsis mediterranei S699: RAM_17405Help
Entry
RAM_17405         CDS       T01822                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RAM_17405
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RAM_17405
   00052 Galactose metabolism
    RAM_17405
   00500 Starch and sucrose metabolism
    RAM_17405
   00520 Amino sugar and nucleotide sugar metabolism
    RAM_17405
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RAM_17405
   00524 Butirosin and neomycin biosynthesis
    RAM_17405
Enzymes [BR:amn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RAM_17405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3704427..3705317
Genome map
AA seq 296 aa AA seqDB search
MSEDRILGIDFGGTKVALGLADRDGTLLATRRLDTDAHAGAEQVVVRALAAARALLADEG
ASPGCIGVVSPGIVLPDRILLAPNVPGWEQLRLAELVAAEFPAVPISVGTDAKAAALAEW
RWGALAGADPAVFLSLGTGIAAAVLVGGRLLTGANGAAGEIGYNLLSPQDTEGFASGAAP
LEEAVGGRGLGGRASELLGRPVTAGELFALAKENVEAKELVTAALDELSMHVANLAIALD
PERIAVGGGLVRSADVLLPALADRLAHAVPFPPQLVAARFDQDAALLGAVALALGG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaggatcggattctcgggatcgacttcggcggcacgaaggtggcgctggggctc
gccgatcgcgacggcaccctgctggcgacccgccggctggacaccgacgcgcacgcgggg
gccgagcaggtggtggtgcgcgcgctcgccgcggccagggctctcctggccgacgagggt
gcgtcgcccggctgcatcggcgtcgtcagcccggggatcgtgctgccggaccgcatcctg
ctcgcgccgaacgtgccgggttgggagcagctgcggctggcggagctggtggccgcggag
ttccccgccgtgccgatctcggtgggcacggacgcgaaggcggcggcgctggcggagtgg
cgctggggcgcgctggccggggccgacccggcggtgttcctgtcactgggcaccggcatc
gcggcggcggtgctggtcggcggccggttgctgaccggcgccaacggagctgcgggcgag
atcgggtacaacctgctctcgccgcaggacaccgagggtttcgcgagcggagcggcgccg
ctcgaggaagccgtcggtgggcgtgggctgggcggccgggcgagcgaactgctcggccgc
ccggtcaccgccggggagctgttcgcgctggccaaggaaaacgtcgaggccaaggagctg
gtgacggccgcgctcgacgaactgtcgatgcacgtggccaacctggcgatcgccctggac
ccggagcgcatcgcggtcggcggcggcctggtccggtccgcggacgtgctgctgccggcg
ctggcggaccggctcgcgcacgcggtgccgttcccgccgcagctggtggccgcccgcttc
gaccaggacgcggcgctgctgggcgcggtggcactcgccctgggcggttag

DBGET integrated database retrieval system