KEGG   Amycolatopsis mediterranei S699: RAM_17550Help
Entry
RAM_17550         CDS       T01822                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00010  Glycolysis / Gluconeogenesis
amn00071  Fatty acid degradation
amn00350  Tyrosine metabolism
amn00625  Chloroalkane and chloroalkene degradation
amn00626  Naphthalene degradation
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01120  Microbial metabolism in diverse environments
amn01130  Biosynthesis of antibiotics
amn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RAM_17550
  Lipid metabolism
   00071 Fatty acid degradation
    RAM_17550
  Amino acid metabolism
   00350 Tyrosine metabolism
    RAM_17550
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RAM_17550
   00626 Naphthalene degradation
    RAM_17550
Enzymes [BR:amn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RAM_17550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AEK41996
UniProt: G0FPS8
Position
3734036..3735058
Genome map
AA seq 340 aa AA seqDB search
MVALPTTMHAWRVLRPGPVAGGPVDLVRAPVPRAGVGELLVRVLVCGVCRTDLHVAEGDL
PVHRQGVTPGHEVVGEVVELGADVTGFATGDRVGIAWLRATCGRCRYCLGGRENLCPESR
YTGWDADGGYAEFAVVPAAYALPLPGGYSDDQLAPLLCAGLIGYRALARAELPEGGRLGL
YGFGGSAHLTAQVAIARGAAVHVLTRSAAARELALELGAASAGEAAEPPPEPLDSAILFA
PVGDLVLPALAALDRGGTLAIAGIHLSDVPPLEYQRHLFQERQVRSVTANTRADAREFLD
FAGRHHLEVSTVPYALDAADRALTDLAADRVNGAAVLRAT
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtggtggcgctgccgacgacgatgcacgcttggcgcgtcctgcggccgggcccggtggcg
ggcgggccggtggacctggtgcgggcgccggtgccgcgggcgggcgtgggggagctgctg
gtgcgggtgctggtgtgcggggtgtgccggacggacctgcacgtggcggagggtgacctg
ccggtgcaccggcagggggtgacgccggggcacgaggtcgtcggcgaagtggtcgagctc
ggcgcggacgtcacgggcttcgcgaccggtgaccgggtggggatcgcgtggctgcgcgcc
acctgcgggcggtgccggtactgcctgggcgggcgcgagaacctgtgtccggagtcgcgg
tacaccggctgggacgccgacggcggctacgcggagttcgcggtcgtcccggcggcgtac
gcgttgccgctgcccggcggctattccgatgaccagctggcgccgctgctctgcgccggg
ctgatcgggtaccgcgcgctcgcacgggcggaactgcccgaaggcggccggctgggcctc
tacgggttcggcggcagcgcgcacctgaccgcccaggtggcgatcgcgcggggtgccgcg
gtgcacgtgctgacgcgcagcgcggccgcccgtgagctggcgctggagctgggggccgcg
tcggccggggaggcggccgagccacctcccgagccgctggactcggcgatcctgttcgcg
cccgtgggtgacctggtgctcccggcgctggccgcgctcgatcgcggcgggacgctcgcc
atcgcgggcatccacctctccgacgtgccgccgctggagtaccagcggcacttgttccag
gaacgtcaggtgcgcagcgtcaccgcgaacacccgggcggacgcgcgggagttcctggac
ttcgccgggcgccatcacctggaggtgagcacggtgccctacgcgctggacgcggcggac
cgggccctgaccgacctggccgcggaccgggtgaacggcgcggcggtgctgcgcgccacc
tga

DBGET integrated database retrieval system