KEGG   Amycolatopsis mediterranei S699: RAM_17715Help
Entry
RAM_17715         CDS       T01822                                 

Definition
(GenBank) L-fuculose-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00051  Fructose and mannose metabolism
amn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    RAM_17715
Enzymes [BR:amn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     RAM_17715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AEK42029
UniProt: G0FPW1
Position
complement(3771022..3771681)
Genome map
AA seq 219 aa AA seqDB search
MLLQAARQAVVAACHDLAGAGLLIGTAGNVSVRVGEHVAVTATGAVLGRITPAQITVVDL
AGTVVAGELAPTSELELHLGIYRRSGAGAVVHTHSPQATAVSCALDELPCVHYQQLLLGG
AVRVAPFAVFGSDELAEHVWTALEGKSAALLANHGAVVHGPTLQAAVDNALLLEWACELY
RNAASIGTPRVLDTAQQAAVIEAALRRGYGSTRRIEEDL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgctcctgcaggccgcgcggcaagcggtggtcgcggcttgccacgacctggccggtgcc
ggcctgctgatcggcaccgcgggcaacgtgagcgtgcgcgtgggtgagcacgtcgcggtc
accgcgaccggcgccgtgctcggacgcatcacgccggcgcagatcaccgtcgtcgacctg
gccgggaccgtggtcgccggggagctcgcgccgacctcggaactggaactgcacctcggg
atctaccgccggtccggcgccggcgcggtcgtgcacacgcactcgccgcaggccaccgcg
gtctcgtgcgcgctcgacgaactcccgtgcgtgcactaccagcagctcctgctcggcggg
gccgtgcgggtcgcccccttcgccgtcttcggcagcgacgagctggccgagcacgtgtgg
accgcactggaaggcaagtcggccgcgctgctggccaaccacggcgccgtcgtgcacggc
cccacgctgcaggcggcggtcgacaacgcgctgctgctcgagtgggcctgcgagctctac
cggaacgccgcgtcgatcggcacccccagagtcctggacaccgcccagcaggccgcggtg
atcgaagccgcgctgcggcgcggctacggcagcacccgacggatcgaggaggatctgtga

DBGET integrated database retrieval system