KEGG   Amycolatopsis mediterranei S699: RAM_21040Help
Entry
RAM_21040         CDS       T01822                                 

Definition
chemotaxis-specific methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:amn02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:amn02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4538784..4539374
Genome map
AA seq 196 aa AA seqDB search
MTPDFPLRFPVVALVTSAGGLDALTRVLAPLPADFPAAVLVAQHLDPARTSHLTAILAAR
TALRVGEAADGDVLVAGAALVVPAGRHLLVTSDARIGLLDTGDLPPARPSADLLLATLAV
TCGPRALAVVLTGKGTDAQTGIRAIAHCGGTVFAQDEGTSAHFGMPGAAIGTGLVHAVLP
LSGIAAAILEHVARHA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgacaccggacttcccgctgcggttcccggtcgtcgccctggtcacgtccgccggtggc
ctcgatgcgctcacccgggtgctcgccccgctgcccgcggacttccccgcggcggtgctc
gtcgcccagcacctggatccggcccggacgagccacctcaccgccatcctcgccgcacgc
accgcgctgcgggtcggcgaggccgctgacggagacgtgctcgtggccggtgcggcactg
gtcgtccccgcggggcggcacctgctggtcacgtcggacgcccggatcgggctgctggac
accggtgatctgccgccggcgcggccgtcggcggatctgctgctggccaccctcgccgtc
acctgcgggccccgtgcgctggcggtcgtcctgacgggcaagggcaccgacgcccagacc
gggatccgggcgatcgcgcactgcggaggcacggtgttcgcccaggacgaggggacgtcc
gcgcacttcggcatgccgggcgccgcgatcggcaccgggctcgtccacgccgtgctcccg
ctgtccggcatcgccgcggccatcctggagcacgtcgcccggcatgcttga

DBGET integrated database retrieval system