KEGG   Amycolatopsis mediterranei S699: RAM_21055Help
Entry
RAM_21055         CDS       T01822                                 

Definition
chemotaxis protein methyltransferase CheR
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:amn02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:amn02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4541271..4543130
Genome map
AA seq 619 aa AA seqDB search
MTEPKEPNGEFESVLAYLKESRGFDFTGYKRSSLMRRVRRRMSQVEIDSYADYIDQLQVN
ADEFVALFNTILINVTGFFRDPDAWDYLRDEVLPALLAERTPEEPIRVWSAGCAAGQEAY
SLAMLLAEALGVEAFRQRVKIYATDVDDEALAQARHAAYSPAEVEGLTEAQLEQYFELVG
SRYCFRKDLRRSIIFGRNDLVQDAPISRIDLLVCRNTLMYFNAETQTKILERFHFALAPR
GVLFLGKAEMLLSHARIFEPLDLKRRVFRKAVNGPVSFAHLVSHGFPQRRTQDISGLEEL
REHAFSASPVAQIVVTEGETTALINAPAEVAFGLSERDIGRPLRDLDVSYRPVALRAYVE
QARLERRSLRIKDVEWRRAGETVWYEVHVNPLVNKDKTLLGVSVVFHDVSWARQLLTELE
HTNRQLESAYEELQSTNEELETTNEELQSTVEELETTNEELQSTNEELETMNEELQSTND
ELQTINDALRERSLDLDEVNEFLESVLTSIHAGIIVIDSEMRIKAWNRGAEDLWGVRREE
AEGTHLLNLDIGLPVADLRPVVREALADPGYYAEQTFEAVNRRGRTTVVRLLCGALRSSN
GESHGALLMMEETKAGRPE
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagcccaaggaacccaacggcgagttcgagtcggtgctggcctacttgaaggag
tcgcggggtttcgacttcaccgggtacaagcggagcagcctgatgcggcgggtccgccgc
cggatgagccaggtggagatcgacagctacgcggactacatcgaccagctgcaggtcaac
gccgacgagttcgtggcgctgttcaacaccatcctgatcaacgtgacggggttcttccgc
gatccggacgcgtgggactacctccgggacgaggtgctccccgcgctgctcgccgagcgc
acgccggaggagccgatccgggtgtggagcgccggctgcgcggccgggcaggaggcctac
agcctggcgatgctgctcgccgaggcgctcggcgtcgaggcgttccggcagcgggtgaag
atctacgccaccgacgtcgacgacgaggcactggcgcaggcccgccacgcggcctacagc
ccggcggaggtcgaagggctcaccgaggcgcagctggagcagtacttcgagctggtgggc
agccggtactgcttccgcaaggacctgcgccggtcgatcatcttcgggcgcaacgacctg
gtgcaggacgcgccgatctcccggatcgacctgctcgtctgccggaacacgttgatgtac
ttcaacgccgagacgcagaccaagatcctcgagcggttccacttcgccctcgccccccgc
ggggtgctgttcctcggcaaggccgagatgctgctgtcgcacgcccggatcttcgagccg
ctggacctcaagcgccgggtcttccgcaaggcggtcaacgggcccgtcagtttcgcccac
ttggtttcccacggcttcccgcagcggcgcacgcaggacatctccgggctggaagaactg
cgtgagcacgcgttttcggcgagcccggtcgcccagatcgtggtcaccgaaggggagacg
acggccctgatcaacgccccggcggaggtggcgttcgggttgtccgaacgcgacatcggc
cggccgctgcgcgacctggacgtctcctaccggccggtggcgctgcgcgcgtacgtcgag
caggcccgcctggaacgccggtcgctgcggatcaaggacgtcgagtggcgccgggccggc
gagaccgtgtggtacgaggtgcacgtcaacccgctggtgaacaaggacaagacgctgctc
ggcgtctcggtggtgttccacgacgtgagctgggcgcgccagctgctcaccgagctcgag
cacacgaaccggcaactggagtccgcctacgaggaactccagtcgaccaacgaggaactc
gagaccaccaacgaggaactccagtccactgtggaggagttggagacgaccaacgaggag
ctccagtccaccaacgaggaactggagacgatgaacgaggagctgcagtccaccaacgac
gagctgcagacgatcaacgacgcgctgcgtgagcgcagcctcgacctcgacgaggtgaac
gagttcctcgagtcggtgctcacttcgatccacgccgggatcatcgtgatcgactccgag
atgcggatcaaggcgtggaaccgcggtgccgaggacctgtggggggtgcggcgggaagaa
gccgaaggcacccacctgctgaacctggacatcggcctgccggtcgcggacctgcgcccc
gtggtgcgcgaggcgctggccgaccccggttactacgccgagcagacgttcgaagcggtc
aaccggcgcggccggaccacggtcgtccggctgctctgcggtgccctgcggagctcgaac
ggcgaaagccacggcgcgctgctgatgatggaagagacgaaggccggccggcccgagtga

DBGET integrated database retrieval system