KEGG   Amycolatopsis mediterranei S699: RAM_21055Help
Entry
RAM_21055         CDS       T01822                                 

Definition
(GenBank) chemotaxis protein methyltransferase CheR
  KO
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:amn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RAM_21055
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RAM_21055
Enzymes [BR:amn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     RAM_21055
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RAM_21055
Two-component system [BR:amn02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RAM_21055
Bacterial motility proteins [BR:amn02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RAM_21055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
CheR CheR_N PAS PAS_4 PAS_9 PAS_8 PAS_10 IncA Spc7 OmpH Methyltransf_12 HMMR_N CALCOCO1 APG17 MCPsignal DUF1664 DUF4795 WEMBL Fez1 DUF3450 PAS_7 HemX PEARLI-4 IFT57 Golgin_A5 HOOK TMF_TATA_bd Methyltransf_25 Exonuc_VII_L Methyltransf_23 ALIX_LYPXL_bnd Atg14 TMPIT KASH_CCD FapA Mnd1 Not3 HAUS-augmin3 DUF3584 EzrA Tropomyosin Methyltransf_31 Prefoldin_3 MCC-bdg_PDZ PAS_3 APG6 LMBR1 DUF2203 ADIP DUF5089 AAA_32 DUF16 HIP1_clath_bdg AAA_13 KxDL DASH_Duo1 AAA_23 HAP1_N DUF4446 Bap31 UPF0449 GAS ZapB Reo_sigmaC DUF2312 bZIP_1 Seryl_tRNA_N Jnk-SapK_ap_N DUF3540 Laminin_II Syntaxin-6_N Med30 RPW8 Flagellin_N FPP STAT_alpha HALZ Uso1_p115_C Fzo_mitofusin WXG100 PCRF NPV_P10 TPR_MLP1_2 Prominin zf-C4H2 TBPIP V_ATPase_I Tropomyosin_1 DUF745 DUF3552 DivIC DUF812 KELK DUF724 Mt_ATP-synt_D Fmp27_WPPW Tweety Cep57_CLD_2
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4541271..4543130
Genome map
AA seq 619 aa AA seqDB search
MTEPKEPNGEFESVLAYLKESRGFDFTGYKRSSLMRRVRRRMSQVEIDSYADYIDQLQVN
ADEFVALFNTILINVTGFFRDPDAWDYLRDEVLPALLAERTPEEPIRVWSAGCAAGQEAY
SLAMLLAEALGVEAFRQRVKIYATDVDDEALAQARHAAYSPAEVEGLTEAQLEQYFELVG
SRYCFRKDLRRSIIFGRNDLVQDAPISRIDLLVCRNTLMYFNAETQTKILERFHFALAPR
GVLFLGKAEMLLSHARIFEPLDLKRRVFRKAVNGPVSFAHLVSHGFPQRRTQDISGLEEL
REHAFSASPVAQIVVTEGETTALINAPAEVAFGLSERDIGRPLRDLDVSYRPVALRAYVE
QARLERRSLRIKDVEWRRAGETVWYEVHVNPLVNKDKTLLGVSVVFHDVSWARQLLTELE
HTNRQLESAYEELQSTNEELETTNEELQSTVEELETTNEELQSTNEELETMNEELQSTND
ELQTINDALRERSLDLDEVNEFLESVLTSIHAGIIVIDSEMRIKAWNRGAEDLWGVRREE
AEGTHLLNLDIGLPVADLRPVVREALADPGYYAEQTFEAVNRRGRTTVVRLLCGALRSSN
GESHGALLMMEETKAGRPE
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagcccaaggaacccaacggcgagttcgagtcggtgctggcctacttgaaggag
tcgcggggtttcgacttcaccgggtacaagcggagcagcctgatgcggcgggtccgccgc
cggatgagccaggtggagatcgacagctacgcggactacatcgaccagctgcaggtcaac
gccgacgagttcgtggcgctgttcaacaccatcctgatcaacgtgacggggttcttccgc
gatccggacgcgtgggactacctccgggacgaggtgctccccgcgctgctcgccgagcgc
acgccggaggagccgatccgggtgtggagcgccggctgcgcggccgggcaggaggcctac
agcctggcgatgctgctcgccgaggcgctcggcgtcgaggcgttccggcagcgggtgaag
atctacgccaccgacgtcgacgacgaggcactggcgcaggcccgccacgcggcctacagc
ccggcggaggtcgaagggctcaccgaggcgcagctggagcagtacttcgagctggtgggc
agccggtactgcttccgcaaggacctgcgccggtcgatcatcttcgggcgcaacgacctg
gtgcaggacgcgccgatctcccggatcgacctgctcgtctgccggaacacgttgatgtac
ttcaacgccgagacgcagaccaagatcctcgagcggttccacttcgccctcgccccccgc
ggggtgctgttcctcggcaaggccgagatgctgctgtcgcacgcccggatcttcgagccg
ctggacctcaagcgccgggtcttccgcaaggcggtcaacgggcccgtcagtttcgcccac
ttggtttcccacggcttcccgcagcggcgcacgcaggacatctccgggctggaagaactg
cgtgagcacgcgttttcggcgagcccggtcgcccagatcgtggtcaccgaaggggagacg
acggccctgatcaacgccccggcggaggtggcgttcgggttgtccgaacgcgacatcggc
cggccgctgcgcgacctggacgtctcctaccggccggtggcgctgcgcgcgtacgtcgag
caggcccgcctggaacgccggtcgctgcggatcaaggacgtcgagtggcgccgggccggc
gagaccgtgtggtacgaggtgcacgtcaacccgctggtgaacaaggacaagacgctgctc
ggcgtctcggtggtgttccacgacgtgagctgggcgcgccagctgctcaccgagctcgag
cacacgaaccggcaactggagtccgcctacgaggaactccagtcgaccaacgaggaactc
gagaccaccaacgaggaactccagtccactgtggaggagttggagacgaccaacgaggag
ctccagtccaccaacgaggaactggagacgatgaacgaggagctgcagtccaccaacgac
gagctgcagacgatcaacgacgcgctgcgtgagcgcagcctcgacctcgacgaggtgaac
gagttcctcgagtcggtgctcacttcgatccacgccgggatcatcgtgatcgactccgag
atgcggatcaaggcgtggaaccgcggtgccgaggacctgtggggggtgcggcgggaagaa
gccgaaggcacccacctgctgaacctggacatcggcctgccggtcgcggacctgcgcccc
gtggtgcgcgaggcgctggccgaccccggttactacgccgagcagacgttcgaagcggtc
aaccggcgcggccggaccacggtcgtccggctgctctgcggtgccctgcggagctcgaac
ggcgaaagccacggcgcgctgctgatgatggaagagacgaaggccggccggcccgagtga

DBGET integrated database retrieval system