KEGG   Amycolatopsis mediterranei S699: RAM_21055Help
Entry
RAM_21055         CDS       T01822                                 

Definition
chemotaxis protein methyltransferase CheR
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:amn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RAM_21055
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RAM_21055
Enzymes [BR:amn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     RAM_21055
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RAM_21055
Two-component system [BR:amn02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RAM_21055
Bacterial motility proteins [BR:amn02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RAM_21055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4541271..4543130
Genome map
AA seq 619 aa AA seqDB search
MTEPKEPNGEFESVLAYLKESRGFDFTGYKRSSLMRRVRRRMSQVEIDSYADYIDQLQVN
ADEFVALFNTILINVTGFFRDPDAWDYLRDEVLPALLAERTPEEPIRVWSAGCAAGQEAY
SLAMLLAEALGVEAFRQRVKIYATDVDDEALAQARHAAYSPAEVEGLTEAQLEQYFELVG
SRYCFRKDLRRSIIFGRNDLVQDAPISRIDLLVCRNTLMYFNAETQTKILERFHFALAPR
GVLFLGKAEMLLSHARIFEPLDLKRRVFRKAVNGPVSFAHLVSHGFPQRRTQDISGLEEL
REHAFSASPVAQIVVTEGETTALINAPAEVAFGLSERDIGRPLRDLDVSYRPVALRAYVE
QARLERRSLRIKDVEWRRAGETVWYEVHVNPLVNKDKTLLGVSVVFHDVSWARQLLTELE
HTNRQLESAYEELQSTNEELETTNEELQSTVEELETTNEELQSTNEELETMNEELQSTND
ELQTINDALRERSLDLDEVNEFLESVLTSIHAGIIVIDSEMRIKAWNRGAEDLWGVRREE
AEGTHLLNLDIGLPVADLRPVVREALADPGYYAEQTFEAVNRRGRTTVVRLLCGALRSSN
GESHGALLMMEETKAGRPE
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagcccaaggaacccaacggcgagttcgagtcggtgctggcctacttgaaggag
tcgcggggtttcgacttcaccgggtacaagcggagcagcctgatgcggcgggtccgccgc
cggatgagccaggtggagatcgacagctacgcggactacatcgaccagctgcaggtcaac
gccgacgagttcgtggcgctgttcaacaccatcctgatcaacgtgacggggttcttccgc
gatccggacgcgtgggactacctccgggacgaggtgctccccgcgctgctcgccgagcgc
acgccggaggagccgatccgggtgtggagcgccggctgcgcggccgggcaggaggcctac
agcctggcgatgctgctcgccgaggcgctcggcgtcgaggcgttccggcagcgggtgaag
atctacgccaccgacgtcgacgacgaggcactggcgcaggcccgccacgcggcctacagc
ccggcggaggtcgaagggctcaccgaggcgcagctggagcagtacttcgagctggtgggc
agccggtactgcttccgcaaggacctgcgccggtcgatcatcttcgggcgcaacgacctg
gtgcaggacgcgccgatctcccggatcgacctgctcgtctgccggaacacgttgatgtac
ttcaacgccgagacgcagaccaagatcctcgagcggttccacttcgccctcgccccccgc
ggggtgctgttcctcggcaaggccgagatgctgctgtcgcacgcccggatcttcgagccg
ctggacctcaagcgccgggtcttccgcaaggcggtcaacgggcccgtcagtttcgcccac
ttggtttcccacggcttcccgcagcggcgcacgcaggacatctccgggctggaagaactg
cgtgagcacgcgttttcggcgagcccggtcgcccagatcgtggtcaccgaaggggagacg
acggccctgatcaacgccccggcggaggtggcgttcgggttgtccgaacgcgacatcggc
cggccgctgcgcgacctggacgtctcctaccggccggtggcgctgcgcgcgtacgtcgag
caggcccgcctggaacgccggtcgctgcggatcaaggacgtcgagtggcgccgggccggc
gagaccgtgtggtacgaggtgcacgtcaacccgctggtgaacaaggacaagacgctgctc
ggcgtctcggtggtgttccacgacgtgagctgggcgcgccagctgctcaccgagctcgag
cacacgaaccggcaactggagtccgcctacgaggaactccagtcgaccaacgaggaactc
gagaccaccaacgaggaactccagtccactgtggaggagttggagacgaccaacgaggag
ctccagtccaccaacgaggaactggagacgatgaacgaggagctgcagtccaccaacgac
gagctgcagacgatcaacgacgcgctgcgtgagcgcagcctcgacctcgacgaggtgaac
gagttcctcgagtcggtgctcacttcgatccacgccgggatcatcgtgatcgactccgag
atgcggatcaaggcgtggaaccgcggtgccgaggacctgtggggggtgcggcgggaagaa
gccgaaggcacccacctgctgaacctggacatcggcctgccggtcgcggacctgcgcccc
gtggtgcgcgaggcgctggccgaccccggttactacgccgagcagacgttcgaagcggtc
aaccggcgcggccggaccacggtcgtccggctgctctgcggtgccctgcggagctcgaac
ggcgaaagccacggcgcgctgctgatgatggaagagacgaaggccggccggcccgagtga

DBGET integrated database retrieval system