KEGG   Amycolatopsis mediterranei S699: RAM_21490Help
Entry
RAM_21490         CDS       T01822                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RAM_21490
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RAM_21490
   00650 Butanoate metabolism
    RAM_21490
  Amino acid metabolism
   00360 Phenylalanine metabolism
    RAM_21490
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RAM_21490
   00622 Xylene degradation
    RAM_21490
   00621 Dioxin degradation
    RAM_21490
Enzymes [BR:amn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RAM_21490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4625601..4626488
Genome map
AA seq 295 aa AA seqDB search
MAAIVGPGNIGTDLLAKLRRSEVIEVGYVVGVVESDGLERARAQGIAASADGVDWLLRQD
PVPQLVFEATSAKAHAANAPRYAEAGIQAIDLTPAHLGPMVCPPVNLGAHLDAPNVSMIT
CGGQATIPMVHAVSRVTAVPYAEIVASVASRGAGPGTRANIDEFTRTTSQAVAEIGGAGR
GKAIIILNPVEPPMIMRDTVFCAIGLDADRDAITASIHEMADEVRKYVPGYSLRADPQFD
DAREEWDGHARVGIFLEVRGNGDYLPEYAGNLDIMTAAAARVGELMARAKQEVPA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgatcgtcggccccggcaacatcggcaccgatttgctggcgaagctgcgacgc
agtgaagtgatcgaagtcggttacgtggtcggcgtggtcgagtcggacggtctcgagcgc
gcccgcgcgcaggggatcgcggcgtccgcggacggcgtcgactggctgctgcgccaggat
cccgtgccccagctcgtgttcgaagcgacgtcggcgaaggcgcacgccgcgaacgcgccg
cggtacgccgaagccggcatccaggcgatcgacctgaccccggcgcacctcggcccgatg
gtgtgcccgccggtgaacctcggcgcgcacctcgacgcgccgaacgtttcgatgatcacc
tgcggcggccaggccacgatccccatggtgcacgccgtttcgcgggtgaccgcggtcccg
tacgccgagatcgtcgcctcggtcgcttcgcggggagcgggccccgggacgcgggcgaac
atcgacgagttcacgcgcacgacgtcgcaggcggtggccgagatcggcggtgccgggcgc
ggcaaggcgatcatcatcctcaacccggtcgagccgccgatgatcatgcgggacacggtg
ttctgcgcgatcggcctcgacgccgaccgcgacgcgatcaccgcgtcgatccacgagatg
gccgacgaagtccgcaagtacgtgccggggtattcgctgcgggcggacccgcagttcgac
gacgcacgcgaggaatgggacgggcacgcgcgggtcggcatcttcctcgaggtccgcggc
aacggcgactacctgcccgagtacgccgggaacctggacatcatgaccgccgcggccgcc
cgcgtgggcgagctgatggcccgcgcgaagcaggaggtgccggcatga

DBGET integrated database retrieval system