KEGG   Amycolatopsis mediterranei S699: RAM_22465Help
Entry
RAM_22465         CDS       T01822                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:amn00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4834380..4836329)
Genome map
AA seq 649 aa AA seqDB search
MVQRYVMSIDQGTTSTRCILFDARGRLVSVVQREHQQHFPRPGWVEHDATEIWRNLSRIV
PQALADAGATAEQVVGLGIANQRETTVLWDRRTGNPVGRAIVWQDTRTDAMLEQLAREPG
ADRVRQLCGLPLATYFSAPRVRWLLERTPGLRERAERGDVLFGTIESWLIWNLTGGAEGG
VHVTDVTNASRTMLMNLRTLSWDDELLEFFDVPRAMLPEIRSSTEVYGTTSRVVPGIRIA
AALGDQQAALFGQTCFAPGEAKCTYGTGSFLLLNTGPTPVLSTHGMLTTVGFKIGDEPAV
YALEGSIAVTGSLVQWFRDGLELIGSAPEIETLARTVEDNGGCYIVPAFSGLFAPHWHSE
ARGVIAGLTSYITKGHLARAVLEATGWQTREVVDAMNADSGLALSTLKVDGGMTADNLLM
QCIADVLDVPVVRPMVAETVSLGAAYAAGLSVGYWPDLEGLRRNWHRAGQWLPAMDPARR
DSEYAHWRQAVELTFGWMRPAPAAAAPGSDLVEVLLADHRRFEQLLRDLRNAEADRPALV
AELSALLVAHTTATERIVRPAAAGSPFAEDLLAVLEGDDFEKALLRLENAVDAHVRGEER
GLLNELRRSMSTSDRTGLGRAFVAERRRQLDLDCGGVDHIRGLGDRLKL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggtccagcggtacgtgatgtccatcgaccagggcaccacctccacccggtgcatcctg
ttcgacgcacgcggccggctcgtctcggtcgtccagcgcgaacaccagcagcacttcccc
cggcccggctgggtcgagcacgacgcgaccgagatctggcggaacctgtcccggatcgtc
ccgcaggcgctggccgacgccggggcgaccgccgagcaggtcgtcgggctcgggatcgcc
aaccagcgcgagaccaccgtcctgtgggaccggcgcaccggcaaccccgtcgggcgggcg
atcgtctggcaggacacccgcaccgacgccatgctcgaacagctcgcccgcgagccgggc
gccgaccgcgtccgtcagctgtgcggcctgcccctggccacgtacttctccgcgccgcgc
gtccgctggctgctcgagcgcacgccgggcctgcgcgagcgcgccgaacgcggcgacgtc
ctcttcggcaccatcgagagctggctgatctggaacctcaccggcggcgccgagggtggc
gtgcacgtcaccgacgtcaccaacgcctcgcgcaccatgctgatgaacctgcgcaccctc
agctgggacgacgagctcctggagttcttcgacgtcccgcgcgcgatgctgccagagatc
cggtcctcgaccgaggtctacggcaccacttcgcgggtggtccccggcatccggatcgcc
gccgcgctcggcgaccagcaggcggcgctgttcggccagacctgcttcgcacccggcgag
gccaagtgcacctacggcaccggcagcttcctgctgctcaacaccggcccgacgccggtg
ctgtccacccacggcatgctcaccacggtcggcttcaagatcggcgacgagcccgcggtg
tacgccctcgaaggctccatcgcggtcaccgggtcgctggtgcagtggttccgggacggc
ctggagctgatcggcagcgcgccggagatcgagacgctggccaggacggtcgaggacaac
ggcggctgctacatcgtgcccgcgttctccggcctgttcgcgccgcactggcacagcgag
gcgcgcggcgtgatcgccgggctgacgtcgtacatcacgaagggccacctggcgcgggcg
gtgctggaggcgaccggctggcagacgcgcgaggtcgtcgacgcgatgaacgccgactcc
gggctggcgctttcgacgttgaaggtcgacggcgggatgaccgcggacaacctgctcatg
cagtgcatcgccgacgtcctcgacgtgccggtggtgcgtccgatggtcgcggagacggtc
tcgctcggcgcggcctacgcggcggggctgtcggtcgggtactggccggacctggagggc
ctgcggcgcaactggcaccgggccggccagtggctgccggcgatggacccggcccgccgc
gactccgaatacgcgcactggcgccaggcggtggagctgacgttcggctggatgcgcccg
gccccggccgcggcggcgcccggttcggacctggtcgaggtgctgctggccgaccaccgc
cggttcgagcagctgctgcgcgacctgcgcaacgccgaagccgaccggccggcgctggtg
gcggagctgtcggccctgctggtcgcccacacgacggcgaccgagcggatcgtccgcccg
gccgcggcgggttctcccttcgccgaggacttgctggcggtcctcgaaggtgacgacttc
gaaaaggcgttgctgcggctggagaacgccgtcgacgctcacgtgcgcggcgaggaacgc
gggctgctgaacgaactgcgccggagtatgtccacttcggaccgcacgggcctgggccgg
gcgttcgtcgcggaacgccgccgccagctcgacctggactgcggtggggtggaccacatc
cgcggactcggtgaccggctgaagctctga

DBGET integrated database retrieval system