KEGG   Amycolatopsis mediterranei S699: RAM_22985Help
Entry
RAM_22985         CDS       T01822                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
amn  Amycolatopsis mediterranei S699
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4958320..4959243
Genome map
AA seq 307 aa AA seqDB search
MPLQYTTNRYVGSAVAAAYLASETDYRAVLTREFDNVTPENEMKWGTVEAVRGQYDWSGA
DAIVEYARTHHKTVRGHTLVWHSQLPDWVGALPADELRRVLHDHITTEVKRYKGKIRAWD
VVNEIFNEDGTRRDTVFRQKLGDGFVADVFRWAHAADPAAKLYLNDYNIEGINPKSDAVY
DLVKTLRRQGVPISGVGIQGHLSIQYGFPGQYRENLARFARIGVETAVTEADVRIPTPPD
AAKLATQASYFGQLWDGCHAVRKCVEFTTWGFTDRHSWVPDVFPGEGAACLFDENLRPKP
AYFRLNP
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctgcaatacaccacgaaccgttacgtcggcagcgcggtggccgcggcgtacctg
gcttcggaaaccgattaccgggcggtgctcacgcgagaattcgacaacgtgacgccggag
aacgagatgaagtggggcacggtcgaagccgtgcgcggccagtacgactggtccggcgcg
gacgcgatcgtcgagtacgcgcggacgcaccacaagaccgtgcgcggccacacgctggtc
tggcactcccagctcccggactgggtcggcgcgctgcccgccgacgagctccgccgggtc
ctgcacgaccacatcaccacggaagtcaagcggtacaagggaaagatccgcgcctgggac
gtcgtcaacgagatcttcaacgaggacggcacccgtcgcgacacggtcttccggcagaag
ctcggcgacggcttcgtcgccgacgtcttccgctgggcgcacgcggccgacccggcggcg
aagctctacctcaacgactacaacatcgaagggatcaacccgaagagcgacgcggtgtac
gacctggtgaagacgctgcggcggcagggcgtgccgatcagcggcgtcggcatccaggga
cacctgtcgatccagtacggcttcccgggtcagtaccgggagaacctggcgcgcttcgcc
aggatcggcgtggagaccgcggtcaccgaggcggacgtccggatcccgaccccgccggac
gcggccaagctcgccacccaggcgagctacttcggtcagctgtgggacggctgccacgcc
gtccgcaagtgcgtcgagttcacgacctggggtttcaccgaccggcactcgtgggtcccg
gacgtcttcccgggtgaaggcgcggcctgcctgttcgacgagaacctgcgcccgaagccg
gcgtacttccgcctcaacccctga

DBGET integrated database retrieval system