KEGG   Amycolatopsis mediterranei S699: RAM_23375Help
Entry
RAM_23375         CDS       T01822                                 

Definition
glucan 1,4-alpha-glucosidase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5049294..5051519
Genome map
AA seq 741 aa AA seqDB search
MISWKALLACTGTAILLAAALPATALATGTATDCCGGGASWATGNKSALGTATTTTSPVW
FTVADGITSEVFYPRADIPNSQDRQFIVTDGSTFVDLERDATNHVVTVPDEKALQYTITN
TAKSGKYRITTDYVTDPARATLVTNTRFQSLDGGSYRLYLLANPSMAGGGANDNAWWDST
GALMASGTETLFGGTATTVVSALRVSTGFTAHDNGYSGAASDCLVDLRADKTLTNQFDAV
SGTGNVVQCGQIPVGTDTTFTVAQGYGDTTAAATSAASGSLSSGFTAVASSYRSGWNAYV
NSLKPAPASVSGDTQRRRAYYVAAMALKTAEDKQHPGASVAGLATPWGNFTNGDQLNDGY
HRVWGRDLYQQATGLLAAGDSAQAKRMAQFLWNAQWIGSPTAGDGMTYPAGSFPRYSPVS
GVAGASAQQLGCCEQLDQDADAILLAWLTGLTDASTYAKVKTTANHIVATGPDTTERWEE
QYGKSPSSVAAEIAGLIAAGAIARANGDTASASSWESTADSWRNSLAGWTVTTSGYWGGH
TYYERLDRAGNPNDTATICFDEGCFYEHDVTDFGFLDLVRLGIRPAGDATIANSVAPTAA
ASDGNSALQVTLPNGDVYFHRYPHDNYGESTANCSGWPAGGAQRFGRLWPVLSGERGQYE
LANGRSAAVYLKSMADSANEGYFVPEQVWDRADVGCFGLGRPTGSAGPLMWAEGQYLRLA
QSMDAGHNLDTPSIVKARYGT
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgatcagctggaaagcactcctggcctgcaccggaacagcaatcctcctagccgcagcc
ctccccgccacggccctggccaccggcaccgcaaccgactgctgcggaggcggagcctcc
tgggcaaccggcaacaagtccgccctcggcaccgccaccaccacgaccagcccagtctgg
ttcaccgtcgccgacggcatcacatccgaggtcttctacccccgagccgacatccccaac
tcccaggaccgccagttcatcgtcaccgacggctcgacgttcgtcgacctggagcgcgac
gccacgaaccacgtggtgaccgtgcccgacgagaaggcactccagtacacgatcacgaac
acggccaagagcggcaaataccggatcaccaccgactacgtcaccgacccggcccgcgcc
acactggtcacgaacacccgcttccagtcgctcgacggcggcagctaccggctctacctg
ctggccaacccgtcgatggcgggcggcggcgcgaacgacaacgcctggtgggactcgacc
ggagccctgatggcgagcggaaccgaaacgctgttcggcggcacggccacgacggtcgtc
tccgcgctgcgcgtctcgaccggcttcaccgcacacgacaacggctacagcggcgcggcc
agcgactgcctggtcgacttgcgcgccgacaagaccttgaccaaccagttcgacgccgtc
tccggcaccggcaacgtcgtccagtgtggacagatcccggtgggcaccgacacgaccttc
accgtcgcgcaaggctacggcgacacgacggcagcggcgacgtccgccgcaagcggctcg
ctgagcagcgggttcaccgcggtggcaagttcctaccgcagcggctggaacgcgtacgtg
aactccctcaaacccgctccggccagcgtttccggagacacgcagcggcgtcgcgcctac
tacgtcgcggccatggcgctgaagaccgccgaagacaaacagcaccccggcgcgagcgtc
gcaggcctcgccaccccctggggcaacttcacgaacggtgaccagctcaacgacggctac
caccgcgtctggggccgcgacctctaccagcaggccaccgggctcctggccgcgggcgac
agcgcgcaggccaagcggatggcccagttcctctggaacgcgcagtggatcggcagcccc
acggccggcgacggcatgacgtacccggcggggtccttcccgcgctacagcccggtgtcc
ggcgtcgccggggcgagcgcccagcagctcggctgctgcgaacagctcgaccaggacgcc
gacgcgatcctgctggcctggctgaccggcctcaccgacgcctcgacctacgccaaggtc
aagacgacggcgaaccacatcgtcgccaccggcccggacaccaccgagcggtgggaggag
cagtacggcaagtcgccgtcttcggtggccgcggagatcgccgggctgatcgcggcgggg
gccatcgcgcgggcgaacggcgacacggcgagcgcgtcgtcgtgggagtccacggcggac
tcgtggcggaactccctggccggctggaccgtcacgacgtccggctactggggcggccac
acctactacgagcgcctcgaccgcgccggcaacccgaacgacaccgcgacgatctgcttc
gacgaaggctgcttctacgaacacgacgtgaccgacttcggcttcctcgacctggtgcgg
ctcggcatccgcccggccggggacgcgacgatcgccaactcggtggcgccgacggccgcg
gcgtcggacggcaactcggcgctgcaggtgacgctgccgaacggcgacgtctacttccac
cggtacccgcacgacaactacggcgagagcaccgcgaactgcagcggctggccggccggc
ggtgcccagcggttcggccggctgtggccggtgctgtcgggggagcgcgggcagtacgag
ctcgccaacggccgctccgccgcggtctacctcaagtccatggcggactcggccaacgaa
ggctacttcgtgcccgagcaggtctgggaccgcgcggacgtcggctgcttcggcctcggc
cggccgaccggcagcgcgggcccgctgatgtgggccgagggccagtacctgcggctggcg
cagagcatggacgcgggccacaacctcgacacgccctcgatcgtcaaggcccgctacggc
acctga

DBGET integrated database retrieval system