KEGG   Amycolatopsis mediterranei S699: RAM_23420Help
Entry
RAM_23420         CDS       T01822                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:amn00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:amn00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:amn00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5061938..5062843
Genome map
AA seq 301 aa AA seqDB search
MDLAALLDRIADDVAPEVGRGAVADYIPALARVAPGRFGMAVAEVDGAVHGVGDWEHPFS
VQSMSKVFTLALTLSRGDDVWARVGREPSGDPFNSLVQLEHEDGIPRNPFINAGALVVTD
ELARHGDAVDALLAFLRQESGRAGIAVDPEVAASEAGHADRNRALAYFMASYGNMRHPVP
SVLDQYVRQCSIAMSCADVARSALFLARHGVRNDGSRLLGLSAAKRINAVMLTCGTYDAA
GEFAYRVGLPGKSGVGGGVLAIVPGRCAVCVWSPGLDARGNSVAGVAALDRFTTLTGWSI
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggacctcgcggcgctgctggaccggatagccgacgacgtcgcgcccgaggtcggccgc
ggcgccgtcgctgactacattcccgcgctggccagggtggcgccggggcggttcggcatg
gcggtggccgaagtggacggtgcggtgcacggcgtcggcgactgggagcacccgttctcc
gtgcagagcatgtccaaagtgttcaccctcgcgctgaccctttcccgcggcgacgacgtg
tgggcgcgggtcggccgcgaaccgtcgggtgatccgttcaattcgctggtgcagctcgaa
cacgaggacggcattccgcgcaacccgttcatcaatgcgggcgcgctggtggtgaccgac
gaactcgcccgccacggcgacgcggtggacgcgctgctcgccttcctccggcaggagagc
ggccgtgcggggatcgccgtggatcccgaggtggcggcgtcggaggcggggcacgccgac
cgcaaccgcgccctcgcgtacttcatggcgtcctacggcaacatgcgccacccggtgccg
tcggtgctggaccagtacgtccgccagtgttcgatcgcgatgagctgcgccgacgtcgcc
cggtcggcgttgttcctggcccgccacggcgtccgcaacgacggctcgcggctgctcggg
ctgagcgcggcgaagcggatcaacgcggtgatgctgacgtgcggcacgtacgacgcggcg
ggcgagttcgcctaccgcgtcggcctcccgggcaagagcggcgtgggcggcggcgtcctg
gcgatcgtcccgggccggtgcgcggtctgcgtgtggagccccgggctggacgcgcgcggc
aactccgtggccggtgtggcggccctggaccggttcacgacgctgaccggctggtcgatc
ttctga

DBGET integrated database retrieval system