KEGG   Amycolatopsis mediterranei S699: RAM_24060Help
Entry
RAM_24060         CDS       T01822                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00240  Pyrimidine metabolism
amn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RAM_24060
Enzymes [BR:amn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RAM_24060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 AAA_14 AAA_25 ATPase_2 AAA_16 RecA
Motif
Other DBs
NCBI-ProteinID: AEK43292
UniProt: G0FT84
Position
5196821..5197492
Genome map
AA seq 223 aa AA seqDB search
MGRLKFCYGPMDCGKSTLALQIDHNHARQGRRGLVLVRHDRSGAPQISSRIGLTRQAVEV
GEDTDVRDLVRQEWAQGRHVDYVVVDEAQFLSPGQVDQLAELADEVEIDVYCFGIATDFR
SRLFPGAARLFELADELQPVQVEVLCWCGLSGRFNARVVDGEVVREGDTVVVADTEQSVV
ETSASARFEAEFATVRYQVLCRRHFRSGDLGPVTAHHGQLRLT
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaggctgaagttctgttacgggccgatggactgcgggaagtcgaccctggcgctg
cagatcgaccacaaccacgcgcggcagggccgccgggggctggtgctggtgcgccacgac
cggtcgggtgcgccgcagatctcgagccggatcgggctgacccggcaggcggtggaggtc
ggtgaggacaccgacgtgcgtgacctggtgcggcaggagtgggcgcaggggcggcacgtg
gactacgtggtggtggacgaggcgcagttcctctcccccggtcaggtcgaccagctggcg
gagctggccgacgaggtcgagatcgacgtctactgcttcgggatcgcgacggacttccgg
agccggttgttcccgggagccgctcgtctgttcgaactggcggacgagttgcagccggtt
caggtggaggtgctgtgctggtgcgggctgtccgggcggttcaacgcgcgggtggtggac
ggcgaggtggtgcgcgagggcgataccgtcgtggtggcagataccgaacaatccgtagtt
gaaacttcagcttcagcacgttttgaggccgaattcgctacggtgcgttatcaggtattg
tgccgccgccactttcgatcgggtgacttgggaccggttactgcccatcacggtcagtta
cggttgacctga

DBGET integrated database retrieval system