KEGG   Amycolatopsis mediterranei S699: RAM_25115Help
Entry
RAM_25115         CDS       T01822                                 

Definition
magnesium chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:amn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5456541..5457938)
Genome map
AA seq 465 aa AA seqDB search
MNAVPDALPRTAGALRAAGFEPRPIAQEIHDNLLSALKNGEDAWPGIVGFSRTVLPQLER
ALLAGHDVVLLGERGQGKTRLLRTLAGLLDEWTPVIEGSELGEHPLQPITPASIRRAAEL
GDDLPVAWRHRSERYTEKLATPDTSVGDLIGDVDPVKVAEGRSLGDPETIHFGLVPRAHR
GIVAINELPDLAERIQVALLNVMEERDIQVRGYTLRLPLDVLLVATANPEDYTNRGRIIT
PLKDRFGAEIRTHYPLDVESEVAVVRQEANLVAEVGEPLLEVLARFVRNLRESTVIDQRS
GVSARFAVAAAETVAAAALRRSALTGEEPAVARPVDLDAVPSVLRGKIEFEPGEEGREIE
HLVHLLRLAIAETARDRFAGLDLRPLADAVGEGHLVSTGERVPGKDVLAALPELPVLHEV
ARRAGVAADEPAGRIAAAVELALESLFLSRRLAKDSDDTTTVYGR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgctgttccagacgctcttccccgcaccgccggggccctgcgcgcggccgggttc
gagccgcgccccatcgcgcaagagatccacgacaacctgctgagcgccctcaagaacggc
gaggacgcctggcccggcatcgtcgggttctcccgcaccgtgctgccgcagctcgaacgc
gcgctgctggccggccacgacgtcgtcctgctcggcgaacgcggccagggcaagacccgc
ctgctgcgcaccctcgccggcctgctcgacgagtggacgcccgtcatcgaaggctccgag
ctgggcgaacacccgctgcagccgatcacgcccgcgtcgatccggcgggccgcggagctc
ggcgacgacctgccggtggcctggcgccaccgctccgagcgctacaccgaaaagctcgcc
acgccggacacctccgtcggcgacctgatcggcgacgtcgacccggtgaaggtcgccgaa
ggccgcagcctcggcgaccccgagacgatccacttcgggctggtcccgcgcgcccaccgc
ggcatcgtcgccatcaacgagctgcccgacctggccgaacgcatccaggtcgcgctgctc
aacgtgatggaggagcgcgacatccaggtccgcggctacacgctgcggctgcccttggac
gtcctgctcgtcgccaccgcgaaccccgaggactacaccaaccgcggccggatcatcacc
ccgctgaaggaccgcttcggcgccgagatccgcacccactaccccttggacgtcgagtcc
gaggtggccgtcgtccggcaggaggcgaacctcgtcgccgaagtcggcgagccgctgctg
gaggtgctcgcccggttcgtccggaacctgcgcgaatcgacggtgatcgaccagcgctcc
ggcgtgtcggcccggttcgccgtcgccgcggcggagaccgtggcggccgcggccctgcgg
cgctcggcgttgacgggggaggagcccgcggtggcccgcccggtcgacctcgacgccgtg
ccgtcggtgctgcgcggcaagatcgagttcgagcccggcgaggagggccgcgagatcgag
cacctcgtgcacctgctgcgcctggcgatcgccgaaaccgcgcgcgaccgcttcgccggc
ctcgacctgcggccgctggccgacgcggtcggcgagggccacctggtctccaccggcgag
cgcgtgccgggcaaggacgtcctcgccgccctgccggagctgccggtgctgcacgaggtc
gcccggcgggccggggttgccgccgacgagcccgccggccggatcgcggccgccgtcgaa
ctcgccctcgaatcgctgttcctgtcgcgaaggcttgccaaggactccgacgacacgacg
accgtctacggccgatga

DBGET integrated database retrieval system