KEGG   Amycolatopsis mediterranei S699: RAM_25790Help
Entry
RAM_25790         CDS       T01822                                 

Definition
glycosyl hydrolase/beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
amn  Amycolatopsis mediterranei S699
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5614356..5615990)
Genome map
AA seq 544 aa AA seqDB search
MRLGIRTAVWTALLAGASLAPPGAAYAASADLLAGHDWAHFSGAEPTAAGVKITPLDRWV
TTPEGKRLQPNPPANLAGPHLDVSGDFGVDALMSVTGGKSAYLQLYGRLPVIYDEWRQER
PSVRVGVVGGKLEVAVWDGGSDKAVETRTFGSGLAGDVAVSISRSGGKVTVSAGGKQLGS
VGEHGAFSAGTVWFGADAQVGGGWTLRALTASGSAKIVDAPAWAQQPSSTSLRAKASALP
RPVRVGSAIASTPLVDDAAYRTIAGREFDALTPENDMKPEFVQPSRGVFAFAEGDMLVDF
ARANGMAVHAHTLVWFEALPTWMRSAPDKKTVMLDHIKAVAGHFAGRVAEWDVVNEPMNE
DNSDGLEHNLWYQAMGVAYIPQAFRAARAADPAATLYLNEYGVEQSGPRWDALYKLVKQL
KADGVPIDGVGMQNHEYEKGDRTPPETFRKHVQALAALGLKVRVSEMDVVSGGDTTMQAK
EFAGKLAVCRDEPNCTTFGMWGFTDRYGSTADIGQYPLAVGDALPWDQNLKPKKAYSAML
AELN
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagactgggaattcgcacggcggtctggacggcgctgctggccggcgcgagcctggcg
ccacccggcgcggcgtacgcggcatcggccgatctgctcgccgggcacgactgggcgcac
ttctccggtgccgaaccgacggcggccggggtgaagatcaccccgctggaccgctgggtg
accacgccggaaggcaaacgcctccagcccaacccgcccgccaacctggccggtccgcac
ctggacgtcagcggcgacttcggcgtcgacgcgctgatgtcggtgaccggcggcaagtcc
gcgtacctgcagctctacggcaggctgccggtgatctacgacgaatggcggcaggaacgg
ccgagcgtgcgcgtcggggtcgtcggcgggaagctcgaggtcgcggtctgggacggcgga
tccgacaaagccgtggagaccaggacgttcggctccggtctcgccggcgacgtcgccgtg
tcgatcagccgcagcggcggcaaggtgaccgtctccgccggcggcaagcagctcggcagt
gtgggcgagcacggcgcgttctccgcgggcaccgtgtggttcggcgcggacgcgcaggtc
ggcggcggctggacgctgcgcgcgttgaccgcgtccggcagcgcgaagatcgtcgacgcg
cccgcttgggcccagcagccgtcgagcacgtcgttgcgcgccaaagcttccgcactgccc
cggccggtccgcgtgggctccgccatcgccagcacgccgctggtcgacgatgccgcctac
cggacgatcgccgggcgcgagttcgacgcgctcacccccgagaacgacatgaagccggag
ttcgtccagccctcgcggggggtgttcgcgttcgccgagggcgatatgctggtcgacttc
gcgcgggcgaacgggatggccgtgcacgcccacaccctggtgtggttcgaggccctgccg
acctggatgcgctcggcgccggacaagaagacggtgatgctcgaccacatcaaggcggtg
gccggccacttcgccggccgggtcgccgaatgggacgtcgtcaacgagccgatgaacgag
gacaactccgacggcctggaacacaacctctggtaccaggcgatgggggtggcctacatc
ccgcaggcgttccgggcggcccgggcggccgacccggccgcgaccttgtacctcaacgaa
tacggcgtcgaacagagcggcccgcgctgggacgcgctgtacaagctggtgaagcagctc
aaggcggacggcgtcccgatcgacggcgtcgggatgcagaaccacgagtacgaaaagggc
gaccggaccccgccggagacgttccgcaagcacgtccaggccctcgccgcgctcgggctg
aaggtccgggtgtccgaaatggacgtcgtgtccggcggggacacgaccatgcaggccaag
gagttcgccggaaagctcgccgtctgccgggacgagccgaactgcacgacgttcgggatg
tgggggttcaccgaccgctacggctcgacggccgacatcgggcagtaccccctcgccgtc
ggggacgcgctgccctgggaccagaacctcaagcccaagaaggcgtactcggccatgctc
gccgagctgaactga

DBGET integrated database retrieval system