KEGG   Amycolatopsis mediterranei S699: RAM_27000Help
Entry
RAM_27000         CDS       T01822                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RAM_27000
Enzymes [BR:amn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RAM_27000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5877853..5878449)
Genome map
AA seq 198 aa AA seqDB search
MISSVRGEVLIVGLDHVVVEVGGVGFAVQATPATLATLRRGEEARLHTALVVREDSLTLF
GFADADARELFGLLQTVSGIGPRLALATLAVLDPGKLRAALVEGNITVLTSVPGIGRKGA
ERLTLELRDKVTALAGTGDVPAVTAPGALRAEVVEALAGLGFPAKQAEQAVDKVLADGDG
HTTAGVLRAALATLGRKR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatctcgtcggtacgcggagaagtcctcatcgtcggcctcgaccacgtcgtggtcgag
gtcggcggggtcggcttcgccgtgcaggccaccccggcgacgctggcgaccctgcgccgc
ggcgaagaggcccggttgcacaccgcgctggtcgtccgcgaggactcgctgacgttgttc
ggcttcgccgacgccgacgcgcgcgagctgttcgggctgctgcagacggtgtccgggatc
gggccgcggctcgcgctggccacccttgccgtgctcgaccccggcaagctgcgggccgcg
ctggtcgaaggcaacatcaccgtgctgacctcggtgccgggcatcggccgcaagggcgcc
gaacggctcaccctcgaactgcgcgacaaggtcaccgcgctcgccggcaccggcgacgtg
ccggccgtcaccgcccccggcgccctgcgtgccgaggtcgtcgaggcgctggccgggctc
gggttcccggccaagcaggccgagcaggccgtggacaaggtcctggccgacggcgacggc
cacaccacggccggcgtgctgcgcgccgcgctggccaccctcggccgcaagcggtag

DBGET integrated database retrieval system