KEGG   Amycolatopsis mediterranei S699: RAM_28475Help
Entry
RAM_28475         CDS       T01822                                 

Definition
stearoyl/acyl-CoA desaturase (delta-9 desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RAM_28475
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RAM_28475
Enzymes [BR:amn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     RAM_28475
Lipid biosynthesis proteins [BR:amn01004]
 Desaturase
  First
   RAM_28475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6188461..6188889)
Genome map
AA seq 142 aa AA seqDB search
MGALTAFFWAGLVRVAVLHHVTWSVNSLCHLIGERPYAARDKSANLWPLAIASMGESWHN
CHHADPTGARHGVRRGRLDVSARLIWLFEKLGWATDVRWPRAEHLARKLNPGYTAAPRGF
GRPARGLFTETPARRPGDGSRS
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgcgctgaccgcgttcttctgggccggcctggtgcgggtggcggtgctgcaccac
gtcacctggtcggtgaactccctgtgccacctgatcggcgaacggccctacgccgcccgc
gacaagtccgcgaacctctggccgctggccatcgcctcgatgggcgagtcctggcacaac
tgccaccacgccgaccccaccggcgcccgccacggcgtccgccgcggccggctcgacgtg
tccgcgcggctgatctggctgttcgagaagctcggctgggccaccgacgtccgctggccg
agggccgaacacctggcccgcaagctcaaccccggttacaccgcggccccccgcgggttc
ggcaggccggcgcgcggattgttcaccgagacgccggcacgccggcccggcgacgggagc
cggtcatga

DBGET integrated database retrieval system