KEGG   Amycolatopsis mediterranei S699: RAM_30535Help
Entry
RAM_30535         CDS       T01822                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:amn00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:amn00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6594511..6595260)
Genome map
AA seq 249 aa AA seqDB search
MTSDLDGRTALVTGGASGIGLACVRALAAAGAKVHVVDIDEHRTEAVASEVGGWAHVADL
TDPTSIDALPAEVDVLVNNAGIQHVAPLEDFPPEVFTRIQALMVTAPFLLIRHTLPAMYA
RGWGRIVNMSSVHGLRASAFKAAYVAAKHGLEGLSKVAALEGAEHGVTSNCVNPGYVRTP
LVDGQIDAQAAEHDIPREDVVAEVLLKRAAIKKLIEPEDVASLVVWLCSPHAGHITGASI
PLDGGWTAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgatctggacgggcgcaccgccctcgtcaccggcggtgcgagcggcatcggc
ctcgcctgcgtccgcgctctcgccgcggccggggcgaaggtgcacgtcgtcgacatcgac
gaacaccgcaccgaggccgtcgcctccgaggtgggcggctgggcgcacgtcgccgacctc
accgaccccacctcgatcgatgccctgcccgccgaagtcgacgtcctggtcaacaacgcc
gggatccagcacgtcgcgcccctcgaagacttcccgcccgaggtcttcacgcggatccag
gccctgatggtcaccgctcctttcctgctcatccggcacaccctccccgcgatgtacgcc
cgggggtggggccggatcgtcaacatgtcgagcgtccacgggctgcgcgcctccgccttc
aaagccgcttacgtcgctgccaaacacggcctagaaggcctgtcgaaggtcgccgccctg
gaaggcgccgaacacggcgtcacgagcaattgcgtgaaccccgggtacgtccgcactccg
ctggtcgacgggcagatcgacgcccaggccgccgagcacgacatcccgcgtgaggacgtc
gtcgccgaggtcctcctcaagcgggccgcgatcaagaagctcatcgaacccgaggacgtc
gcttccctggtggtgtggctgtgctccccgcacgccggccacatcaccggggcctccatc
ccgctcgacggcggttggaccgccgcttaa

DBGET integrated database retrieval system